• Gene id: 6777

Gene Summary

• Gene Symbol: STAT5B   Gene   UCSC   Ensembl
• Aliases: STAT5
• Gene name: signal transducer and activator of transcription 5B
• Alternate names: signal transducer and activator of transcription 5B, transcription factor STAT5B,
• Gene location: 17q21.2 (42288436: 42199176)     Exons: 22     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that tran
• OMIM: 604260

Protein Summary

• Protein general information: P51692  
  • Name: Signal transducer and activator of transcription 5B
  • Length: 787  
  • Mass: 89866
• Sequence:

  MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGLVQELQKKAEHQ
  VGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNGSSPAGSLADAMSQKHLQINQTFEE
  LRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQY
  RVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
  QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKLNVHMNPPQVKATIIS
  EQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKRSDRRGAESVTEEKFTILFESQFSV
  GGNELVFQVKTLSLPVVVIVHGSQDNNATATVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGL
  TKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
  QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRLGDLNYLIYVFPDRPK
  DEVYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAGGGSATYMDQAPSPAVCPQAHYNMYPQNPDSV
  LDTDGDFDLEDTMDVARRVEELLGRPMDSQWIPHAQS

• Structural information:
  • Protein Domains: (589..68-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191"-)
  • Interpro: IPR008967  IPR000980  IPR036860  IPR001217  IPR035858   IPR035886  IPR036535  IPR013800  IPR015988  IPR013801  IPR012345  IPR013799  
  • Prosite: PS50001
  • CDD: cd10420
  • PDB: 6MBW 6MBZ
  • PDBsum: 6MBW 6MBZ
  • STRING: ENSP00000293328
• Other Databases: GeneCards:  STAT5B  Malacards:  STAT5B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0042127	regulation of cell population proliferation	IBA	biological process
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0007259	receptor signaling pathway via JAK-STAT	IBA	biological process
GO:0006952	defense response	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0060397	growth hormone receptor signaling pathway via JAK-STAT	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0043434	response to peptide hormone	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0045648	positive regulation of erythrocyte differentiation	IDA	biological process
GO:0071363	cellular response to growth factor stimulus	ISS	biological process
GO:0003682	chromatin binding	ISS	molecular function
GO:0071364	cellular response to epidermal growth factor stimulus	ISS	biological process
GO:0046983	protein dimerization activity	ISS	molecular function
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0060397	growth hormone receptor signaling pathway via JAK-STAT	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003700	DNA-binding transcription factor activity	TAS	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	TAS	biological process
GO:0007259	receptor signaling pathway via JAK-STAT	TAS	biological process
GO:0035723	interleukin-15-mediated signaling pathway	TAS	biological process
GO:0060397	growth hormone receptor signaling pathway via JAK-STAT	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0038110	interleukin-2-mediated signaling pathway	TAS	biological process
GO:0038111	interleukin-7-mediated signaling pathway	TAS	biological process
GO:0038113	interleukin-9-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070672	response to interleukin-15	IEA	biological process
GO:0070669	response to interleukin-2	IEA	biological process
GO:0060397	growth hormone receptor signaling pathway via JAK-STAT	IEA	biological process
GO:0046983	protein dimerization activity	IEA	molecular function
GO:0046544	development of secondary male sexual characteristics	IEA	biological process
GO:0045954	positive regulation of natural killer cell mediated cytotoxicity	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0045647	negative regulation of erythrocyte differentiation	IEA	biological process
GO:0045621	positive regulation of lymphocyte differentiation	IEA	biological process
GO:0045588	positive regulation of gamma-delta T cell differentiation	IEA	biological process
GO:0045579	positive regulation of B cell differentiation	IEA	biological process
GO:0042104	positive regulation of activated T cell proliferation	IEA	biological process
GO:0033077	T cell differentiation in thymus	IEA	biological process
GO:0032825	positive regulation of natural killer cell differentiation	IEA	biological process
GO:0019915	lipid storage	IEA	biological process
GO:0019218	regulation of steroid metabolic process	IEA	biological process
GO:0007548	sex differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0001779	natural killer cell differentiation	IEA	biological process
GO:0097531	mast cell migration	IEA	biological process
GO:0071363	cellular response to growth factor stimulus	IEA	biological process
GO:0070670	response to interleukin-4	IEA	biological process
GO:0050729	positive regulation of inflammatory response	IEA	biological process
GO:0048541	Peyer's patch development	IEA	biological process
GO:0046543	development of secondary female sexual characteristics	IEA	biological process
GO:0045931	positive regulation of mitotic cell cycle	IEA	biological process
GO:0045086	positive regulation of interleukin-2 biosynthetic process	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0043029	T cell homeostasis	IEA	biological process
GO:0042448	progesterone metabolic process	IEA	biological process
GO:0040018	positive regulation of multicellular organism growth	IEA	biological process
GO:0040014	regulation of multicellular organism growth	IEA	biological process
GO:0032819	positive regulation of natural killer cell proliferation	IEA	biological process
GO:0030856	regulation of epithelial cell differentiation	IEA	biological process
GO:0030155	regulation of cell adhesion	IEA	biological process
GO:0019530	taurine metabolic process	IEA	biological process
GO:0019221	cytokine-mediated signaling pathway	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0007595	lactation	IEA	biological process
GO:0007565	female pregnancy	IEA	biological process
GO:0007259	receptor signaling pathway via JAK-STAT	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0001553	luteinization	IEA	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0035259	glucocorticoid receptor binding	IPI	molecular function
GO:0032355	response to estradiol	IDA	biological process
GO:0019530	taurine metabolic process	ISS	biological process positive effect
GO:0040014	regulation of multicellular organism growth	ISS	biological process
GO:0032870	cellular response to hormone stimulus	IDA	biological process
GO:0060397	growth hormone receptor signaling pathway via JAK-STAT	IDA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05166	Human T-cell leukemia virus 1 infection
hsa04062	Chemokine signaling pathway
hsa05203	Viral carcinogenesis
hsa04217	Necroptosis
hsa04630	JAK-STAT signaling pathway
hsa05161	Hepatitis B
hsa04935	Growth hormone synthesis, secretion and action
hsa05162	Measles
hsa04659	Th17 cell differentiation
hsa04658	Th1 and Th2 cell differentiation
hsa04012	ErbB signaling pathway
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa05220	Chronic myeloid leukemia
hsa04917	Prolactin signaling pathway
hsa05221	Acute myeloid leukemia
hsa05223	Non-small cell lung cancer

Diseases

Associated diseases	References
Growth hormone insensitivity with immunodeficiency	KEGG:H00931
Growth hormone insensitivity with immunodeficiency	KEGG:H00931
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R