• Gene id: 6776

Gene Summary

• Gene Symbol: STAT5A   Gene   UCSC   Ensembl
• Aliases: MGF, STAT5
• Gene name: signal transducer and activator of transcription 5A
• Alternate names: signal transducer and activator of transcription 5A, epididymis secretory sperm binding protein,
• Gene location: 17q21.2 (42287546: 42311942)     Exons: 20     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that tran
• OMIM: 601717

Protein Summary

• Protein general information: P42229  
  • Name: Signal transducer and activator of transcription 5A
  • Length: 794  
  • Mass: 90647
• Sequence:

  MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQLLEGLVQELQKKAEHQ
  VGEDGFLLKIKLGHYATQLQKTYDRCPLELVRCIRHILYNEQRLVREANNCSSPAGILVDAMSQKHLQINQTFEE
  LRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFAQLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQY
  RVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
  QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKLNVHMNPPQVKATIIS
  EQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKRADRRGAESVTEEKFTVLFESQFSV
  GSNELVFQVKTLSLPVVVIVHGSQDHNATATVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGL
  TKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
  QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRLGDLSYLIYVFPDRPK
  DEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADAGGSSATYMDQAPSPAVCPQAPYNMYPQNPDHVLDQDG
  EFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS

• Structural information:
  • Protein Domains: (589..68-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191"-)
  • Interpro: IPR008967  IPR000980  IPR036860  IPR001217  IPR035858   IPR036535  IPR013800  IPR015988  IPR013801  IPR012345  IPR013799  
  • Prosite: PS50001
  • DIP: 396
  • STRING: ENSP00000341208
• Other Databases: GeneCards:  STAT5A  Malacards:  STAT5A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0043434	response to peptide hormone	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0060397	growth hormone receptor signaling pathway via JAK-STAT	IBA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0006952	defense response	IBA	biological process
GO:0007259	receptor signaling pathway via JAK-STAT	IBA	biological process
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0042127	regulation of cell population proliferation	IBA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0060397	growth hormone receptor signaling pathway via JAK-STAT	IEA	biological process
GO:0007595	lactation	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003700	DNA-binding transcription factor activity	TAS	molecular function
GO:0003700	DNA-binding transcription factor activity	TAS	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	TAS	biological process
GO:0007259	receptor signaling pathway via JAK-STAT	TAS	biological process
GO:0038026	reelin-mediated signaling pathway	IDA	biological process
GO:0035723	interleukin-15-mediated signaling pathway	TAS	biological process
GO:0060397	growth hormone receptor signaling pathway via JAK-STAT	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0038110	interleukin-2-mediated signaling pathway	TAS	biological process
GO:0038111	interleukin-7-mediated signaling pathway	TAS	biological process
GO:0038113	interleukin-9-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019530	taurine metabolic process	ISS	biological process positive effect
GO:0040014	regulation of multicellular organism growth	ISS	biological process
GO:0043536	positive regulation of blood vessel endothelial cell migration	IMP	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05166	Human T-cell leukemia virus 1 infection
hsa05203	Viral carcinogenesis
hsa04217	Necroptosis
hsa04630	JAK-STAT signaling pathway
hsa05161	Hepatitis B
hsa04935	Growth hormone synthesis, secretion and action
hsa05162	Measles
hsa04659	Th17 cell differentiation
hsa04658	Th1 and Th2 cell differentiation
hsa04012	ErbB signaling pathway
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa05220	Chronic myeloid leukemia
hsa04917	Prolactin signaling pathway
hsa05221	Acute myeloid leukemia
hsa05223	Non-small cell lung cancer

Diseases

Associated diseases	References
Ductal carcinoma in situ	PMID:15609129
Ductal carcinoma in situ	PMID:16133357
Invasive lobular carcinoma	PMID:15609129
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq