Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 6774
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol STAT3   Gene   UCSC   Ensembl
Aliases ADMIO, ADMIO1, APRF, HIES
Gene name signal transducer and activator of transcription 3
Alternate names signal transducer and activator of transcription 3, DNA-binding protein APRF, acute-phase response factor,
Gene location 17q21.2 (42388502: 42313323)     Exons: 24     NC_000017.11
Gene summary(Entrez) The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the ce
OMIM 102582

Protein Summary
Protein general information P40763  

Name: Signal transducer and activator of transcription 3 (Acute phase response factor)

Length: 770  Mass: 88,068

Sequence MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQES
NVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQD
VRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLL
SAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDV
AALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGL
KIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQL
TTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYP
DIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGG
QFESLTFDMELTSECATSPM
Structural information
Protein Domains
 SH2. (580-670)
Interpro:  IPR008967  IPR000980  IPR036860  IPR001217  IPR035855  
IPR036535  IPR013800  IPR015988  IPR013801  IPR012345  IPR013799  
Prosite:   PS50001
CDD:   cd10374

PDB:  		 5AX3 5U5S
PDBsum:   5AX3 5U5S

DIP:  
33584
MINT:  
STRING:   ENSP00000264657
Other Databases GeneCards:  STAT3  Malacards:  STAT3

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0000122 negative regulation of tr
anscription from RNA poly
merase II promoter
 TAS biological process
GO:0000790 nuclear chromatin
 IDA cellular component
GO:0000978 RNA polymerase II core pr
omoter proximal region se
quence-specific DNA bindi
ng
 IDA molecular function
GO:0000978 RNA polymerase II core pr
omoter proximal region se
quence-specific DNA bindi
ng
 IDA molecular function
GO:0001077 transcriptional activator
activity, RNA polymerase
II core promoter proxima
l region sequence-specifi
c binding
 IMP molecular function
GO:0001103 RNA polymerase II repress
ing transcription factor
binding
 IPI molecular function
GO:0001228 transcriptional activator
activity, RNA polymerase
II transcription regulat
ory region sequence-speci
fic binding
 IDA molecular function
GO:0001659 temperature homeostasis
 ISS biological process
GO:0001754 eye photoreceptor cell di
fferentiation
 ISS biological process
GO:0003677 DNA binding
 ISS molecular function
GO:0003700 transcription factor acti
vity, sequence-specific D
NA binding
 IDA molecular function
GO:0004871 signal transducer activit
y
 TAS molecular function
GO:0004879 RNA polymerase II transcr
iption factor activity, l
igand-activated sequence-
specific DNA binding
 IDA molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005634 nucleus
 ISS cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005737 cytoplasm
 ISS cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:0005743 mitochondrial inner membr
ane
 IEA cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005886 plasma membrane
 ISS cellular component
GO:0006355 regulation of transcripti
on, DNA-templated
 IDA biological process
GO:0006355 regulation of transcripti
on, DNA-templated
 IDA biological process
GO:0006357 regulation of transcripti
on from RNA polymerase II
promoter
 ISS biological process
GO:0006366 transcription from RNA po
lymerase II promoter
 IEA biological process
GO:0006606 protein import into nucle
us
 IDA biological process
GO:0006928 movement of cell or subce
llular component
 TAS biological process
GO:0006953 acute-phase response
 IEA biological process
GO:0007165 signal transduction
 TAS biological process
GO:0007165 signal transduction
 TAS biological process
GO:0007259 JAK-STAT cascade
 TAS biological process
GO:0007399 nervous system developmen
t
 TAS biological process
GO:0007568 aging
 IEA biological process
GO:0008134 transcription factor bind
ing
 IPI molecular function
GO:0008283 cell proliferation
 IEA biological process
GO:0008285 negative regulation of ce
ll proliferation
 IEA biological process
GO:0010628 positive regulation of ge
ne expression
 IDA biological process
GO:0010628 positive regulation of ge
ne expression
 IMP biological process
GO:0010730 negative regulation of hy
drogen peroxide biosynthe
tic process
 IEA biological process
GO:0016032 viral process
 IEA biological process
GO:0016310 phosphorylation
 ISS biological process
GO:0019221 cytokine-mediated signali
ng pathway
 NAS biological process
GO:0019901 protein kinase binding
 ISS molecular function
GO:0019903 protein phosphatase bindi
ng
 IPI molecular function
GO:0019953 sexual reproduction
 ISS biological process
GO:0030522 intracellular receptor si
gnaling pathway
 IDA biological process
GO:0031490 chromatin DNA binding
 IDA molecular function
GO:0031730 CCR5 chemokine receptor b
inding
 IEA molecular function
GO:0032355 response to estradiol
 IDA biological process
GO:0032870 cellular response to horm
one stimulus
 IDA biological process
GO:0033210 leptin-mediated signaling
pathway
 IDA biological process
GO:0035019 somatic stem cell populat
ion maintenance
 TAS biological process
GO:0035259 glucocorticoid receptor b
inding
 IEA molecular function
GO:0035278 miRNA mediated inhibition
of translation
 IDA biological process
GO:0040014 regulation of multicellul
ar organism growth
 IEA biological process
GO:0042493 response to drug
 IEA biological process
GO:0042517 positive regulation of ty
rosine phosphorylation of
Stat3 protein
 TAS biological process
GO:0042593 glucose homeostasis
 ISS biological process
GO:0042755 eating behavior
 ISS biological process
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0043066 negative regulation of ap
optotic process
 IMP biological process
GO:0044212 transcription regulatory
region DNA binding
 IDA molecular function
GO:0044320 cellular response to lept
in stimulus
 IDA biological process
GO:0044321 response to leptin
 IDA biological process
GO:0045471 response to ethanol
 IEA biological process
GO:0045747 positive regulation of No
tch signaling pathway
 ISS biological process
GO:0045820 negative regulation of gl
ycolytic process
 IEA biological process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 ISS biological process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 IDA biological process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 IMP biological process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IMP biological process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IMP biological process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IDA biological process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IGI biological process
GO:0046902 regulation of mitochondri
al membrane permeability
 IEA biological process
GO:0046983 protein dimerization acti
vity
 ISS molecular function
GO:0048708 astrocyte differentiation
 ISS biological process
GO:0051726 regulation of cell cycle
 IDA biological process
GO:0060019 radial glial cell differe
ntiation
 ISS biological process
GO:0060259 regulation of feeding beh
avior
 ISS biological process
GO:0060396 growth hormone receptor s
ignaling pathway
 IDA biological process
GO:0060397 JAK-STAT cascade involved
in growth hormone signal
ing pathway
 ISS biological process
GO:0060397 JAK-STAT cascade involved
in growth hormone signal
ing pathway
 IDA biological process
GO:0070102 interleukin-6-mediated si
gnaling pathway
 IDA biological process
GO:0070102 interleukin-6-mediated si
gnaling pathway
 IDA biological process
GO:0070102 interleukin-6-mediated si
gnaling pathway
 IMP biological process
GO:0070102 interleukin-6-mediated si
gnaling pathway
 IMP biological process
GO:0070102 interleukin-6-mediated si
gnaling pathway
 IDA biological process
GO:0071407 cellular response to orga
nic cyclic compound
 IEA biological process
GO:0090575 RNA polymerase II transcr
iption factor complex
 IC cellular component
GO:0090575 RNA polymerase II transcr
iption factor complex
 IMP cellular component
GO:0097009 energy homeostasis
 ISS biological process
GO:1901215 negative regulation of ne
uron death
 IEA biological process
GO:1902728 positive regulation of gr
owth factor dependent ske
letal muscle satellite ce
ll proliferation
 IEA biological process
GO:1902895 positive regulation of pr
i-miRNA transcription fro
m RNA polymerase II promo
ter
 IDA biological process
GO:1902895 positive regulation of pr
i-miRNA transcription fro
m RNA polymerase II promo
ter
 IDA biological process
GO:1904685 positive regulation of me
talloendopeptidase activi
ty
 IGI biological process
GO:2000637 positive regulation of ge
ne silencing by miRNA
 IDA biological process
GO:2001171 positive regulation of AT
P biosynthetic process
 IEA biological process
GO:2001223 negative regulation of ne
uron migration
 IEA biological process
GO:0000122 negative regulation of tr
anscription from RNA poly
merase II promoter
 TAS biological process
GO:0000790 nuclear chromatin
 IDA cellular component
GO:0000978 RNA polymerase II core pr
omoter proximal region se
quence-specific DNA bindi
ng
 IDA molecular function
GO:0000978 RNA polymerase II core pr
omoter proximal region se
quence-specific DNA bindi
ng
 IDA molecular function
GO:0000981 RNA polymerase II transcr
iption factor activity, s
equence-specific DNA bind
ing
 IEA molecular function
GO:0001077 transcriptional activator
activity, RNA polymerase
II core promoter proxima
l region sequence-specifi
c binding
 IMP molecular function
GO:0001103 RNA polymerase II repress
ing transcription factor
binding
 IPI molecular function
GO:0001228 transcriptional activator
activity, RNA polymerase
II transcription regulat
ory region sequence-speci
fic binding
 IDA molecular function
GO:0001659 temperature homeostasis
 IEA biological process
GO:0001659 temperature homeostasis
 ISS biological process
GO:0001754 eye photoreceptor cell di
fferentiation
 IEA biological process
GO:0001754 eye photoreceptor cell di
fferentiation
 ISS biological process
GO:0003677 DNA binding
 IEA molecular function
GO:0003677 DNA binding
 IEA molecular function
GO:0003677 DNA binding
 ISS molecular function
GO:0003677 DNA binding
 IEA molecular function
GO:0003700 transcription factor acti
vity, sequence-specific D
NA binding
 IEA molecular function
GO:0003700 transcription factor acti
vity, sequence-specific D
NA binding
 IDA molecular function
GO:0003700 transcription factor acti
vity, sequence-specific D
NA binding
 TAS molecular function
GO:0003700 transcription factor acti
vity, sequence-specific D
NA binding
 TAS molecular function
GO:0004871 signal transducer activit
y
 IEA molecular function
GO:0004871 signal transducer activit
y
 TAS molecular function
GO:0004879 RNA polymerase II transcr
iption factor activity, l
igand-activated sequence-
specific DNA binding
 IDA molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005634 nucleus
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0005634 nucleus
 ISS cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005737 cytoplasm
 ISS cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:0005737 cytoplasm
 TAS cellular component
GO:0005739 mitochondrion
 IEA cellular component
GO:0005743 mitochondrial inner membr
ane
 IEA cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005886 plasma membrane
 IEA cellular component
GO:0005886 plasma membrane
 ISS cellular component
GO:0006351 transcription, DNA-templa
ted
 IEA biological process
GO:0006355 regulation of transcripti
on, DNA-templated
 IEA biological process
GO:0006355 regulation of transcripti
on, DNA-templated
 IEA biological process
GO:0006355 regulation of transcripti
on, DNA-templated
 IDA biological process
GO:0006355 regulation of transcripti
on, DNA-templated
 IDA biological process
GO:0006357 regulation of transcripti
on from RNA polymerase II
promoter
 ISS biological process
GO:0006357 regulation of transcripti
on from RNA polymerase II
promoter
 TAS biological process
GO:0006366 transcription from RNA po
lymerase II promoter
 IEA biological process
GO:0006606 protein import into nucle
us
 IDA biological process
GO:0006928 movement of cell or subce
llular component
 TAS biological process
GO:0006953 acute-phase response
 IEA biological process
GO:0007165 signal transduction
 IEA biological process
GO:0007165 signal transduction
 TAS biological process
GO:0007165 signal transduction
 TAS biological process
GO:0007259 JAK-STAT cascade
 TAS biological process
GO:0007259 JAK-STAT cascade
 TAS biological process
GO:0007399 nervous system developmen
t
 TAS biological process
GO:0007568 aging
 IEA biological process
GO:0008134 transcription factor bind
ing
 IEA molecular function
GO:0008134 transcription factor bind
ing
 IPI molecular function
GO:0008283 cell proliferation
 IEA biological process
GO:0008285 negative regulation of ce
ll proliferation
 IEA biological process
GO:0010033 response to organic subst
ance
 IEA biological process
GO:0010628 positive regulation of ge
ne expression
 IDA biological process
GO:0010628 positive regulation of ge
ne expression
 IMP biological process
GO:0010730 negative regulation of hy
drogen peroxide biosynthe
tic process
 IEA biological process
GO:0014070 response to organic cycli
c compound
 IEA biological process
GO:0016032 viral process
 IEA biological process
GO:0016310 phosphorylation
 IEA biological process
GO:0016310 phosphorylation
 ISS biological process
GO:0019221 cytokine-mediated signali
ng pathway
 NAS biological process
GO:0019827 stem cell population main
tenance
 IEA biological process
GO:0019901 protein kinase binding
 IEA molecular function
GO:0019901 protein kinase binding
 ISS molecular function
GO:0019903 protein phosphatase bindi
ng
 IPI molecular function
GO:0019953 sexual reproduction
 IEA biological process
GO:0019953 sexual reproduction
 ISS biological process
GO:0030522 intracellular receptor si
gnaling pathway
 IDA biological process
GO:0031490 chromatin DNA binding
 IDA molecular function
GO:0031730 CCR5 chemokine receptor b
inding
 IEA molecular function
GO:0032355 response to estradiol
 IEA biological process
GO:0032355 response to estradiol
 IDA biological process
GO:0032870 cellular response to horm
one stimulus
 IDA biological process
GO:0033210 leptin-mediated signaling
pathway
 IEA biological process
GO:0033210 leptin-mediated signaling
pathway
 IDA biological process
GO:0034097 response to cytokine
 IEA biological process
GO:0035019 somatic stem cell populat
ion maintenance
 TAS biological process
GO:0035259 glucocorticoid receptor b
inding
 IEA molecular function
GO:0035278 miRNA mediated inhibition
of translation
 IDA biological process
GO:0040014 regulation of multicellul
ar organism growth
 IEA biological process
GO:0042493 response to drug
 IEA biological process
GO:0042517 positive regulation of ty
rosine phosphorylation of
Stat3 protein
 TAS biological process
GO:0042593 glucose homeostasis
 IEA biological process
GO:0042593 glucose homeostasis
 ISS biological process
GO:0042755 eating behavior
 IEA biological process
GO:0042755 eating behavior
 ISS biological process
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0043066 negative regulation of ap
optotic process
 IMP biological process
GO:0043434 response to peptide hormo
ne
 IEA biological process
GO:0043565 sequence-specific DNA bin
ding
 IEA molecular function
GO:0044212 transcription regulatory
region DNA binding
 IDA molecular function
GO:0044320 cellular response to lept
in stimulus
 IDA biological process
GO:0044321 response to leptin
 IEA biological process
GO:0044321 response to leptin
 IDA biological process
GO:0045471 response to ethanol
 IEA biological process
GO:0045747 positive regulation of No
tch signaling pathway
 IEA biological process
GO:0045747 positive regulation of No
tch signaling pathway
 ISS biological process
GO:0045820 negative regulation of gl
ycolytic process
 IEA biological process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 IEA biological process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 ISS biological process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 IDA biological process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 IMP biological process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IEA biological process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IMP biological process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IMP biological process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IDA biological process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IGI biological process
GO:0046902 regulation of mitochondri
al membrane permeability
 IEA biological process
GO:0046983 protein dimerization acti
vity
 IEA molecular function
GO:0046983 protein dimerization acti
vity
 ISS molecular function
GO:0048708 astrocyte differentiation
 IEA biological process
GO:0048708 astrocyte differentiation
 ISS biological process
GO:0051726 regulation of cell cycle
 IEA biological process
GO:0051726 regulation of cell cycle
 IDA biological process
GO:0060019 radial glial cell differe
ntiation
 IEA biological process
GO:0060019 radial glial cell differe
ntiation
 ISS biological process
GO:0060259 regulation of feeding beh
avior
 IEA biological process
GO:0060259 regulation of feeding beh
avior
 ISS biological process
GO:0060396 growth hormone receptor s
ignaling pathway
 IDA biological process
GO:0060397 JAK-STAT cascade involved
in growth hormone signal
ing pathway
 IEA biological process
GO:0060397 JAK-STAT cascade involved
in growth hormone signal
ing pathway
 ISS biological process
GO:0060397 JAK-STAT cascade involved
in growth hormone signal
ing pathway
 IDA biological process
GO:0060548 negative regulation of ce
ll death
 IEA biological process
GO:0070102 interleukin-6-mediated si
gnaling pathway
 IDA biological process
GO:0070102 interleukin-6-mediated si
gnaling pathway
 IDA biological process
GO:0070102 interleukin-6-mediated si
gnaling pathway
 IMP biological process
GO:0070102 interleukin-6-mediated si
gnaling pathway
 IMP biological process
GO:0070102 interleukin-6-mediated si
gnaling pathway
 IDA biological process
GO:0071345 cellular response to cyto
kine stimulus
 IEA biological process
GO:0071407 cellular response to orga
nic cyclic compound
 IEA biological process
GO:0090575 RNA polymerase II transcr
iption factor complex
 IC cellular component
GO:0090575 RNA polymerase II transcr
iption factor complex
 IMP cellular component
GO:0097009 energy homeostasis
 IEA biological process
GO:0097009 energy homeostasis
 ISS biological process
GO:1901215 negative regulation of ne
uron death
 IEA biological process
GO:1902728 positive regulation of gr
owth factor dependent ske
letal muscle satellite ce
ll proliferation
 IEA biological process
GO:1902895 positive regulation of pr
i-miRNA transcription fro
m RNA polymerase II promo
ter
 IDA biological process
GO:1902895 positive regulation of pr
i-miRNA transcription fro
m RNA polymerase II promo
ter
 IDA biological process
GO:1904685 positive regulation of me
talloendopeptidase activi
ty
 IGI biological process
GO:2000637 positive regulation of ge
ne silencing by miRNA
 IDA biological process
GO:2001171 positive regulation of AT
P biosynthetic process
 IEA biological process
GO:2001223 negative regulation of ne
uron migration
 IEA biological process
GO:0000122 negative regulation of tr
anscription from RNA poly
merase II promoter
 TAS biological process
GO:0000790 nuclear chromatin
 IDA cellular component
GO:0000978 RNA polymerase II core pr
omoter proximal region se
quence-specific DNA bindi
ng
 IDA molecular function
GO:0000978 RNA polymerase II core pr
omoter proximal region se
quence-specific DNA bindi
ng
 IDA molecular function
GO:0001077 transcriptional activator
activity, RNA polymerase
II core promoter proxima
l region sequence-specifi
c binding
 IMP molecular function
GO:0001103 RNA polymerase II repress
ing transcription factor
binding
 IPI molecular function
GO:0001228 transcriptional activator
activity, RNA polymerase
II transcription regulat
ory region sequence-speci
fic binding
 IDA molecular function
GO:0001659 temperature homeostasis
 ISS biological process
GO:0001754 eye photoreceptor cell di
fferentiation
 ISS biological process
GO:0003677 DNA binding
 ISS molecular function
GO:0003700 transcription factor acti
vity, sequence-specific D
NA binding
 IDA molecular function
GO:0003700 transcription factor acti
vity, sequence-specific D
NA binding
 TAS molecular function
GO:0003700 transcription factor acti
vity, sequence-specific D
NA binding
 TAS molecular function
GO:0004871 signal transducer activit
y
 TAS molecular function
GO:0004879 RNA polymerase II transcr
iption factor activity, l
igand-activated sequence-
specific DNA binding
 IDA molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005634 nucleus
 ISS cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005737 cytoplasm
 ISS cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:0005737 cytoplasm
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005886 plasma membrane
 ISS cellular component
GO:0006355 regulation of transcripti
on, DNA-templated
 IDA biological process
GO:0006355 regulation of transcripti
on, DNA-templated
 IDA biological process
GO:0006357 regulation of transcripti
on from RNA polymerase II
promoter
 ISS biological process
GO:0006357 regulation of transcripti
on from RNA polymerase II
promoter
 TAS biological process
GO:0006606 protein import into nucle
us
 IDA biological process
GO:0006928 movement of cell or subce
llular component
 TAS biological process
GO:0007165 signal transduction
 TAS biological process
GO:0007165 signal transduction
 TAS biological process
GO:0007259 JAK-STAT cascade
 TAS biological process
GO:0007259 JAK-STAT cascade
 TAS biological process
GO:0007399 nervous system developmen
t
 TAS biological process
GO:0008134 transcription factor bind
ing
 IPI molecular function
GO:0010628 positive regulation of ge
ne expression
 IDA biological process
GO:0010628 positive regulation of ge
ne expression
 IMP biological process
GO:0016310 phosphorylation
 ISS biological process
GO:0019221 cytokine-mediated signali
ng pathway
 NAS biological process
GO:0019901 protein kinase binding
 ISS molecular function
GO:0019903 protein phosphatase bindi
ng
 IPI molecular function
GO:0019953 sexual reproduction
 ISS biological process
GO:0030522 intracellular receptor si
gnaling pathway
 IDA biological process
GO:0031490 chromatin DNA binding
 IDA molecular function
GO:0032355 response to estradiol
 IDA biological process
GO:0032870 cellular response to horm
one stimulus
 IDA biological process
GO:0033210 leptin-mediated signaling
pathway
 IDA biological process
GO:0035019 somatic stem cell populat
ion maintenance
 TAS biological process
GO:0035278 miRNA mediated inhibition
of translation
 IDA biological process
GO:0042517 positive regulation of ty
rosine phosphorylation of
Stat3 protein
 TAS biological process
GO:0042593 glucose homeostasis
 ISS biological process
GO:0042755 eating behavior
 ISS biological process
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0042802 identical protein binding
 IPI molecular function
GO:0043066 negative regulation of ap
optotic process
 IMP biological process
GO:0044212 transcription regulatory
region DNA binding
 IDA molecular function
GO:0044320 cellular response to lept
in stimulus
 IDA biological process
GO:0044321 response to leptin
 IDA biological process
GO:0045747 positive regulation of No
tch signaling pathway
 ISS biological process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 ISS biological process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 IDA biological process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 IMP biological process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IMP biological process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IMP biological process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IDA biological process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 IGI biological process
GO:0046983 protein dimerization acti
vity
 ISS molecular function
GO:0048708 astrocyte differentiation
 ISS biological process
GO:0051726 regulation of cell cycle
 IDA biological process
GO:0060019 radial glial cell differe
ntiation
 ISS biological process
GO:0060259 regulation of feeding beh
avior
 ISS biological process
GO:0060396 growth hormone receptor s
ignaling pathway
 IDA biological process
GO:0060397 JAK-STAT cascade involved
in growth hormone signal
ing pathway
 ISS biological process
GO:0060397 JAK-STAT cascade involved
in growth hormone signal
ing pathway
 IDA biological process
GO:0070102 interleukin-6-mediated si
gnaling pathway
 IDA biological process
GO:0070102 interleukin-6-mediated si
gnaling pathway
 IDA biological process
GO:0070102 interleukin-6-mediated si
gnaling pathway
 IMP biological process
GO:0070102 interleukin-6-mediated si
gnaling pathway
 IMP biological process
GO:0070102 interleukin-6-mediated si
gnaling pathway
 IDA biological process
GO:0090575 RNA polymerase II transcr
iption factor complex
 IC cellular component
GO:0090575 RNA polymerase II transcr
iption factor complex
 IMP cellular component
GO:0097009 energy homeostasis
 ISS biological process
GO:1902895 positive regulation of pr
i-miRNA transcription fro
m RNA polymerase II promo
ter
 IDA biological process
GO:1902895 positive regulation of pr
i-miRNA transcription fro
m RNA polymerase II promo
ter
 IDA biological process
GO:1904685 positive regulation of me
talloendopeptidase activi
ty
 IGI biological process
GO:2000637 positive regulation of ge
ne silencing by miRNA
 IDA biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04066HIF-1 signaling pathway
hsa04068FoxO signaling pathway
hsa04217Necroptosis
hsa04550Signaling pathways regulating pluripotency of stem cells
hsa04659Th17 cell differentiation
hsa04062Chemokine signaling pathway
hsa04920Adipocytokine signaling pathway
hsa04917Prolactin signaling pathway
hsa05200Pathways in cancer
hsa05206MicroRNAs in cancer
hsa05205Proteoglycans in cancer
hsa05203Viral carcinogenesis
hsa05235PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05212Pancreatic cancer
hsa05221Acute myeloid leukemia
hsa05223Non-small cell lung cancer
hsa05321Inflammatory bowel disease
hsa04931Insulin resistance
hsa04933AGE-RAGE signaling pathway in diabetic complications
hsa05162Measles
hsa05161Hepatitis B
hsa05160Hepatitis C
hsa05163Human cytomegalovirus infection
hsa05167Kaposi sarcoma-associated herpesvirus infection
hsa05169Epstein-Barr virus infection
hsa05145Toxoplasmosis
hsa01521EGFR tyrosine kinase inhibitor resistance

Diseases

Expand All | Collapse All
Associated diseases References
Cancer GAD: 20802378
Cancer (Hepatocellular) GAD: 19817957
Cancer (lung) GAD: 19789190
Cancer (lymphoma) GAD: 18636124
Cancer (thyroid) GAD: 19730683
Cancer (breast) GAD: 17639043
Cancer (oral) KEGG: H00016
Cancer (meningeal) GAD: 20406964
Cancer (myeloid leukemia) GAD: 20065083
Cancer (ovarian) GAD: 20628624
Cardiovascular disease GAD: 16807407
Cleft defects GAD: 18978678
Asthma GAD: 15935090
Autoimmune diseases GAD: 20962850
Ulcerative colitis GAD: 18438405
Multiple sclerosis GAD: 20200543
Crohn's disease GAD: 18587394
Diabetes GAD: 19110536
Insulin resistance GAD: 18239666
Obesity GAD: 17636079
Fatty liver GAD: 18789715
Psychological disorders GAD: 18504423
Recurrent pregnancy loss (RPL) GAD: 20059466
Endometriosis INFBASE: 25750101
Polycystic ovary syndrome (PCOS) INFBASE: 17895321
Unexplained infertility INFBASE: 18047677
Teratozoospermia MIK: 26209830
Dermatitis GAD: 20816194
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Regulates differentiation of mammalian stem and progenitor spermatogonia. MIK: 22378757
Teratozoospermia MIK: 17327269
Teratozoospermia MIK: 26209830
Unexplained infertility MIK: 25753583

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
26209830 Teratozoos
permia
37 men provided
semen samples
for routine ana
lysis
 Male infertility Bad
GSK-3
HSP27
JNK/SAPK
mTOR
p38 MAPK
p53PARP
Caspase-3
Akt
Stat1 and p70 S6 kinase
 Show abstract
22378757 Regulates
differenti
ation of m
ammalian s
tem and pr
ogenitor s
permatogon
ia.

Male infertility
Show abstract
17327269 Teratozoos
permia
13 (5 controls,
8 cases)
 Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract
25753583 Unexplaine
d infertil
ity
46 (17 fertile
men, 29 male pa
tients)
 Male infertility Microarray
 Show abstract