Male Infertility Database

Search Result

Gene id

6772

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed

Gene Summary

Gene Symbol

STAT1 Gene UCSC Ensembl

Aliases

CANDF7, IMD31A, IMD31B, IMD31C, ISGF-3, STAT91

Gene name

signal transducer and activator of transcription 1

Alternate names

signal transducer and activator of transcription 1-alpha/beta, signal transducer and activator of transcription 1, 91kD, signal transducer and activator of transcription 1, 91kDa, transcription factor ISGF-3 components p91/p84,

Gene location

2q32.2 (191014249: 190968988) Exons: 26 NC_000002.12

Gene summary(Entrez)

The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the ce

OMIM

600555

Protein Summary

Protein general information

P42224

Name: Signal transducer and activator of transcription 1 alpha/beta (Transcription factor ISGF 3 components p91/p84)

Length: 750 Mass: 87,335

Sequence

MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLEN
NFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVK
DKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTE
LTQNALINDELVEWKRRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQV
LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKVKVLFDKDVNERNTVK
GFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTNEGPLIVTEELHSLSFETQLCQPGLVIDLET
TSLPVVVISNVSQLPSGWASILWYNMLVAEPRNLSFFLTPPCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEK
LLGPNASPDGLIPWTRFCKENINDKNFPFWLWIESILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFL
LRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDH
AFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEFDSMMNTV

Structural information

Protein Domains	SH2. (573-670)
Interpro:	IPR008967 IPR000980 IPR036860 IPR001217 IPR038295 IPR035859 IPR022752 IPR036535 IPR013800 IPR015988 IPR013801 IPR012345 IPR013799
Prosite:	PS50001
CDD:	cd10372
PDB:	1BF5 1YVL 2KA6 3WWT
PDBsum:	1BF5 1YVL 2KA6 3WWT
DIP:	46140
MINT:
STRING:	ENSP00000354394

Other Databases

GeneCards: STAT1 Malacards: STAT1

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological process
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular function
GO:0000979	RNA polymerase II core pr omoter sequence-specific DNA binding	IDA	molecular function
GO:0000983	transcription factor acti vity, RNA polymerase II c ore promoter sequence-spe cific	IDA	molecular function
GO:0001937	negative regulation of en dothelial cell proliferat ion	IMP	biological process
GO:0002053	positive regulation of me senchymal cell proliferat ion	ISS	biological process
GO:0003340	negative regulation of me senchymal to epithelial t ransition involved in met anephros morphogenesis	ISS	biological process
GO:0003690	double-stranded DNA bindi ng	IDA	molecular function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular function
GO:0004871	signal transducer activit y	IEA	molecular function
GO:0005164	tumor necrosis factor rec eptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006351	transcription, DNA-templa ted	IEA	biological process
GO:0006915	apoptotic process	ISS	biological process
GO:0007259	JAK-STAT cascade	IDA	biological process
GO:0008015	blood circulation	ISS	biological process
GO:0016032	viral process	IEA	biological process
GO:0016525	negative regulation of an giogenesis	IMP	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0030424	axon	ISS	cellular component
GO:0030425	dendrite	ISS	cellular component
GO:0033209	tumor necrosis factor-med iated signaling pathway	IDA	biological process
GO:0034097	response to cytokine	ISS	biological process
GO:0035456	response to interferon-be ta	IMP	biological process
GO:0035458	cellular response to inte rferon-beta	IMP	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042981	regulation of apoptotic p rocess	TAS	biological process
GO:0043124	negative regulation of I- kappaB kinase/NF-kappaB s ignaling	IMP	biological process
GO:0043434	response to peptide hormo ne	ISS	biological process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological process
GO:0046725	negative regulation by vi rus of viral protein leve ls in host cell	IMP	biological process
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular component
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	ISS	biological process
GO:0051591	response to cAMP	ISS	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	ISS	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	IDA	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0060334	regulation of interferon- gamma-mediated signaling pathway	TAS	biological process
GO:0060337	type I interferon signali ng pathway	ISS	biological process
GO:0060337	type I interferon signali ng pathway	TAS	biological process
GO:0060338	regulation of type I inte rferon-mediated signaling pathway	TAS	biological process
GO:0061326	renal tubule development	IMP	biological process
GO:0071407	cellular response to orga nic cyclic compound	IEA	biological process
GO:0072136	metanephric mesenchymal c ell proliferation involve d in metanephros developm ent	ISS	biological process
GO:0072162	metanephric mesenchymal c ell differentiation	ISS	biological process
GO:0072308	negative regulation of me tanephric nephron tubule epithelial cell different iation	ISS	biological process
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular function
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	IDA	biological process
GO:0043542	endothelial cell migratio n	IMP	biological process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological process
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular function
GO:0000979	RNA polymerase II core pr omoter sequence-specific DNA binding	IDA	molecular function
GO:0000983	transcription factor acti vity, RNA polymerase II c ore promoter sequence-spe cific	IDA	molecular function
GO:0001937	negative regulation of en dothelial cell proliferat ion	IMP	biological process
GO:0002053	positive regulation of me senchymal cell proliferat ion	ISS	biological process
GO:0003340	negative regulation of me senchymal to epithelial t ransition involved in met anephros morphogenesis	ISS	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003690	double-stranded DNA bindi ng	IDA	molecular function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular function
GO:0004871	signal transducer activit y	IEA	molecular function
GO:0005164	tumor necrosis factor rec eptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006351	transcription, DNA-templa ted	IEA	biological process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological process
GO:0006915	apoptotic process	ISS	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007259	JAK-STAT cascade	IDA	biological process
GO:0008015	blood circulation	ISS	biological process
GO:0016032	viral process	IEA	biological process
GO:0016525	negative regulation of an giogenesis	IMP	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0030424	axon	ISS	cellular component
GO:0030425	dendrite	ISS	cellular component
GO:0033209	tumor necrosis factor-med iated signaling pathway	IDA	biological process
GO:0034097	response to cytokine	ISS	biological process
GO:0035456	response to interferon-be ta	IMP	biological process
GO:0035458	cellular response to inte rferon-beta	IMP	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042981	regulation of apoptotic p rocess	TAS	biological process
GO:0043124	negative regulation of I- kappaB kinase/NF-kappaB s ignaling	IMP	biological process
GO:0043434	response to peptide hormo ne	ISS	biological process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological process
GO:0046725	negative regulation by vi rus of viral protein leve ls in host cell	IMP	biological process
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular component
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	ISS	biological process
GO:0051591	response to cAMP	ISS	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	ISS	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	IDA	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0060334	regulation of interferon- gamma-mediated signaling pathway	TAS	biological process
GO:0060337	type I interferon signali ng pathway	ISS	biological process
GO:0060337	type I interferon signali ng pathway	TAS	biological process
GO:0060338	regulation of type I inte rferon-mediated signaling pathway	TAS	biological process
GO:0061326	renal tubule development	IMP	biological process
GO:0071345	cellular response to cyto kine stimulus	IEA	biological process
GO:0071407	cellular response to orga nic cyclic compound	IEA	biological process
GO:0072136	metanephric mesenchymal c ell proliferation involve d in metanephros developm ent	ISS	biological process
GO:0072162	metanephric mesenchymal c ell differentiation	ISS	biological process
GO:0072308	negative regulation of me tanephric nephron tubule epithelial cell different iation	ISS	biological process
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular function
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	IDA	biological process
GO:0043542	endothelial cell migratio n	IMP	biological process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological process
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular function
GO:0000979	RNA polymerase II core pr omoter sequence-specific DNA binding	IDA	molecular function
GO:0000983	transcription factor acti vity, RNA polymerase II c ore promoter sequence-spe cific	IDA	molecular function
GO:0001937	negative regulation of en dothelial cell proliferat ion	IMP	biological process
GO:0002053	positive regulation of me senchymal cell proliferat ion	ISS	biological process
GO:0003340	negative regulation of me senchymal to epithelial t ransition involved in met anephros morphogenesis	ISS	biological process
GO:0003690	double-stranded DNA bindi ng	IDA	molecular function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular function
GO:0005164	tumor necrosis factor rec eptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006915	apoptotic process	ISS	biological process
GO:0007259	JAK-STAT cascade	IDA	biological process
GO:0008015	blood circulation	ISS	biological process
GO:0016525	negative regulation of an giogenesis	IMP	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0030424	axon	ISS	cellular component
GO:0030425	dendrite	ISS	cellular component
GO:0033209	tumor necrosis factor-med iated signaling pathway	IDA	biological process
GO:0034097	response to cytokine	ISS	biological process
GO:0035456	response to interferon-be ta	IMP	biological process
GO:0035458	cellular response to inte rferon-beta	IMP	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042981	regulation of apoptotic p rocess	TAS	biological process
GO:0043124	negative regulation of I- kappaB kinase/NF-kappaB s ignaling	IMP	biological process
GO:0043434	response to peptide hormo ne	ISS	biological process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological process
GO:0046725	negative regulation by vi rus of viral protein leve ls in host cell	IMP	biological process
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular component
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	ISS	biological process
GO:0051591	response to cAMP	ISS	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	ISS	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	IDA	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0060334	regulation of interferon- gamma-mediated signaling pathway	TAS	biological process
GO:0060337	type I interferon signali ng pathway	ISS	biological process
GO:0060337	type I interferon signali ng pathway	TAS	biological process
GO:0060338	regulation of type I inte rferon-mediated signaling pathway	TAS	biological process
GO:0061326	renal tubule development	IMP	biological process
GO:0072136	metanephric mesenchymal c ell proliferation involve d in metanephros developm ent	ISS	biological process
GO:0072162	metanephric mesenchymal c ell differentiation	ISS	biological process
GO:0072308	negative regulation of me tanephric nephron tubule epithelial cell different iation	ISS	biological process
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular function
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	IDA	biological process
GO:0043542	endothelial cell migratio n	IMP	biological process

KEGG pathways

Expand All | Collapse All

Pathway id	Pathway name
hsa04217	Necroptosis
hsa04620	Toll-like receptor signaling pathway
hsa04621	NOD-like receptor signaling pathway
hsa04625	C-type lectin receptor signaling pathway
hsa04658	Th1 and Th2 cell differentiation
hsa04659	Th17 cell differentiation
hsa04062	Chemokine signaling pathway
hsa04917	Prolactin signaling pathway
hsa04919	Thyroid hormone signaling pathway
hsa04380	Osteoclast differentiation
hsa05200	Pathways in cancer
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05212	Pancreatic cancer
hsa05321	Inflammatory bowel disease
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa05152	Tuberculosis
hsa05162	Measles
hsa05164	Influenza A
hsa05161	Hepatitis B
hsa05160	Hepatitis C
hsa05168	Herpes simplex virus 1 infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05169	Epstein-Barr virus infection
hsa05165	Human papillomavirus infection
hsa05145	Toxoplasmosis
hsa05140	Leishmaniasis

Diseases

Expand All | Collapse All

Associated diseases	References
Cancer	GAD: 17909067
Cancer (bladder)	GAD: 19692168
Cancer (lymphoma)	GAD: 18633131
Cancer (Medullary)	GAD: 17909067
Cancer (meningeal)	GAD: 20406964
Cancer (myeloid leukemia)	GAD: 20065083
Cancer (ovarian)	GAD: 20628624
Cancer (cervical)	GAD: 19012493
Cancer (glioblastoma)	GAD: 19423540
Cancer (Hepatocellular)	GAD: 20798561
Cancer (lung)	GAD: 18676680
Cancer (breast)	GAD: 18950845
Multiple sclerosis	GAD: 19604093
Systemic lupus erythematosus (SLE)	GAD: 18803832
Hypersensitivity	GAD: 17983380
Osteoporosis	GAD: 19594299
Bone diseases	GAD: 19453261
Preeclampsia	INFBASE: 24931237
Male factor infertility	MIK: 11476770
Varicocele	MIK: 26209830
Spermatogenesis defects	MIK: 26209830
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Male factor infertility	MIK: 11476770
Teratozoospermia	MIK: 17327269
Varicocele	MIK: 26209830
Spermatogenetic defects	MIK: 26209830

PubMed references

Expand All | Collapse All

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
11476770	Male facto r infertil ity	9 sperm donors	Male infertility	TYK 2 STAT 1 IFN-alpha IFN-gamma IL-12 TYK 2 STAT 4	Show abstract
26209830	Varicocele , Spermato genetic de fects	37 men provided semen samples for routine ana lysis	Male infertility	Bad GSK-3 HSP27 JNK/SAPK mTOR p38 MAPK p53PARP Caspase-3 Akt Stat1 and p70 S6 kinase	Show abstract
17327269	Teratozoos permia	19 (6 controls , 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
21674046	Aberrant C pGs in Low Motility Sperm	18	Male infertility	GSE26881	Show abstract
28606200	Cryptorchi dism	Monozgotic twin s (1 control, I cwith cryptorc hidism)	Male infertility	MeDIP-Seq	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways Expand All | Collapse All

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Diseases

Expand All | Collapse All