• Gene id: 6770

Gene Summary

• Gene Symbol: STAR   Gene   UCSC   Ensembl
• Aliases: STARD1
• Gene name: steroidogenic acute regulatory protein
• Alternate names: steroidogenic acute regulatory protein, mitochondrial, START domain containing 1, START domain-containing protein 1, StAR related lipid transfer (START) domain containing 1, cholesterol trafficker, mitochondrial steroid acute regulatory protein, steroid acute r,
• Gene location: 8p11.23 (38150951: 38142699)     Exons: 7     NC_000008.11
• Gene summary(Entrez): The protein encoded by this gene plays a key role in the acute regulation of steroid hormone synthesis by enhancing the conversion of cholesterol into pregnenolone. This protein permits the cleavage of cholesterol into pregnenolone by mediating the transp
• OMIM: 600617

Protein Summary

• Protein general information: P49675  
  • Name: Steroidogenic acute regulatory protein, mitochondrial (StAR) (START domain containing protein 1) (StARD1)
  • Length: 285  
  • Mass: 31914
  • Tissue specificity: Expressed in gonads, adrenal cortex and kidney.
• Sequence:

  MLLATFKLCAGSSYRHMRNMKGLRQQAVMAISQELNRRALGGPTPSTWINQVRRRSSLLGSRLEETLYSDQELAY
  LQQGEEAMQKALGILSNQEGWKKESQQDNGDKVMSKVVPDVGKVFRLEVVVDQPMERLYEELVERMEAMGEWNPN
  VKEIKVLQKIGKDTFITHELAAEAAGNLVGPRDFVSVRCAKRRGSTCVLAGMATDFGNMPEQKGVIRAEHGPTCM
  VLHPLAGSPSKTKLTWLLSIDLKGWLPKSIINQVLSQTQVDFANHLRKRLESHPASEARC

• Structural information:
  • Protein Domains: (67..28-)
    (/note="START-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00197"-)
  • Interpro: IPR029866  IPR000799  IPR023393  IPR002913  
  • Prosite: PS50848
  • CDD: cd08905
  • PDB: 1IMG 2I93 3P0L 5OMA
  • PDBsum: 1IMG 2I93 3P0L 5OMA
  • STRING: ENSP00000276449
• Other Databases: GeneCards:  STAR  Malacards:  STAR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IBA	cellular component
GO:0005758	mitochondrial intermembrane space	IBA	cellular component
GO:0006694	steroid biosynthetic process	IBA	biological process
GO:0015485	cholesterol binding	IBA	molecular function
GO:0032367	intracellular cholesterol transport	IBA	biological process
GO:0050810	regulation of steroid biosynthetic process	IBA	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0006694	steroid biosynthetic process	IEA	biological process
GO:0015485	cholesterol binding	IEA	molecular function
GO:0120020	cholesterol transfer activity	IEA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0006694	steroid biosynthetic process	IEA	biological process
GO:0006869	lipid transport	IEA	biological process
GO:0006694	steroid biosynthetic process	TAS	biological process
GO:0005758	mitochondrial intermembrane space	TAS	cellular component
GO:0005758	mitochondrial intermembrane space	TAS	cellular component
GO:0006700	C21-steroid hormone biosynthetic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071872	cellular response to epinephrine stimulus	IEA	biological process
GO:0071560	cellular response to transforming growth factor beta stimulus	IEA	biological process
GO:0071373	cellular response to luteinizing hormone stimulus	IEA	biological process
GO:0071372	cellular response to follicle-stimulating hormone stimulus	IEA	biological process
GO:0071371	cellular response to gonadotropin stimulus	IEA	biological process
GO:0071346	cellular response to interferon-gamma	IEA	biological process
GO:0071333	cellular response to glucose stimulus	IEA	biological process
GO:0071320	cellular response to cAMP	IEA	biological process
GO:0071312	cellular response to alkaloid	IEA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0061370	testosterone biosynthetic process	IEA	biological process
GO:0060992	response to fungicide	IEA	biological process
GO:0050769	positive regulation of neurogenesis	IEA	biological process
GO:0048545	response to steroid hormone	IEA	biological process
GO:0048168	regulation of neuronal synaptic plasticity	IEA	biological process
GO:0046677	response to antibiotic	IEA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0044344	cellular response to fibroblast growth factor stimulus	IEA	biological process
GO:0043627	response to estrogen	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0018879	biphenyl metabolic process	IEA	biological process
GO:0017085	response to insecticide	IEA	biological process
GO:0016101	diterpenoid metabolic process	IEA	biological process
GO:0014823	response to activity	IEA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0010288	response to lead ion	IEA	biological process
GO:0010033	response to organic substance	IEA	biological process
GO:0009636	response to toxic substance	IEA	biological process
GO:0009635	response to herbicide	IEA	biological process
GO:0007584	response to nutrient	IEA	biological process
GO:0006703	estrogen biosynthetic process	IEA	biological process
GO:0006699	bile acid biosynthetic process	IEA	biological process
GO:0006082	organic acid metabolic process	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0008211	glucocorticoid metabolic process	IEA	biological process
GO:0071549	cellular response to dexamethasone stimulus	IEA	biological process
GO:0071407	cellular response to organic cyclic compound	IEA	biological process
GO:0071378	cellular response to growth hormone stimulus	IEA	biological process
GO:0071276	cellular response to cadmium ion	IEA	biological process
GO:0071248	cellular response to metal ion	IEA	biological process
GO:0071236	cellular response to antibiotic	IEA	biological process
GO:0051412	response to corticosterone	IEA	biological process
GO:0044321	response to leptin	IEA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0043434	response to peptide hormone	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0042747	circadian sleep/wake cycle, REM sleep	IEA	biological process
GO:0042542	response to hydrogen peroxide	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0035457	cellular response to interferon-alpha	IEA	biological process
GO:0035094	response to nicotine	IEA	biological process
GO:0034698	response to gonadotropin	IEA	biological process
GO:0032367	intracellular cholesterol transport	IEA	biological process
GO:0031667	response to nutrient levels	IEA	biological process
GO:0030061	mitochondrial crista	IEA	cellular component
GO:0018963	phthalate metabolic process	IEA	biological process
GO:0018958	phenol-containing compound metabolic process	IEA	biological process
GO:0018894	dibenzo-p-dioxin metabolic process	IEA	biological process
GO:0017143	insecticide metabolic process	IEA	biological process
GO:0010212	response to ionizing radiation	IEA	biological process
GO:0008584	male gonad development	IEA	biological process
GO:0007623	circadian rhythm	IEA	biological process
GO:0007420	brain development	IEA	biological process
GO:0005758	mitochondrial intermembrane space	IEA	cellular component
GO:0050810	regulation of steroid biosynthetic process	IEA	biological process
GO:0044255	cellular lipid metabolic process	IEA	biological process
GO:0015485	cholesterol binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0015485	cholesterol binding	IDA	molecular function
GO:0070859	positive regulation of bile acid biosynthetic process	IDA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0120009	intermembrane lipid transfer	IEA	biological process
GO:0008203	cholesterol metabolic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04934	Cushing syndrome
hsa04925	Aldosterone synthesis and secretion
hsa04927	Cortisol synthesis and secretion
hsa04979	Cholesterol metabolism
hsa04913	Ovarian steroidogenesis

Diseases

Associated diseases	References
Congenital adrenal hyperplasia	KEGG:H00216
Congenital adrenal hyperplasia	KEGG:H00216
Congenital adrenal hyperplasia	PMID:8634702
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq