• Gene id: 677

Gene Summary

• Gene Symbol: ZFP36L1   Gene   UCSC   Ensembl
• Aliases: BRF1, Berg36, ERF-1, ERF1, RNF162B, TIS11B, cMG1
• Gene name: ZFP36 ring finger protein like 1
• Alternate names: mRNA decay activator protein ZFP36L1, EGF-response factor 1, TPA-induced sequence 11b, ZFP36-like 1, butyrate response factor 1, early response factor Berg36, zinc finger protein 36, C3H type-like 1, zinc finger protein 36, C3H1 type-like 1, zinc finger protein, ,
• Gene location: 14q24.1 (68796242: 68787654)     Exons: 4     NC_000014.9
• Gene summary(Entrez): This gene is a member of the TIS11 family of early response genes, which are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. This gene is well conserved across species and has a promoter that contains motifs seen
• OMIM: 601064

SNPs

rs17855750

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000016.10   g.28503907A>C
NC_000016.10   g.28503907A>T
NC_000016.9   g.28515228A>C
NC_000016.9   g.28515228A>T
NM_145659.3   c.175T>G
NM_145659.3   c.175T>A
XM_011545780.2   c.181T>G
XM_011545780.2   c.181T>A
NP_663634.2   p.Ser59Ala
NP_663634.2   p.Ser59Thr
XP_01154  

rs2231829

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000020.11   g.45547937G>A
NC_000020.10   g.44176576G>A|SEQ=[G/A]|GENE=EPPIN
EPPIN-WFDC6   100526773

rs699664

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000002.12   g.85553413C>T
NC_000002.11   g.85780536C>T
NG_011811.2   g.13122G>A
NM_000821.7   c.974G>A
NM_000821.6   c.974G>A
NM_000821.5   c.974G>A
NM_001142269.4   c.803G>A
NM_001142269.3   c.803G>A
NM_001142269.2   c.803G>A
XM_005264259.5   c.974G>A
XM_005264259.1  

rs11594

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000020.11   g.45542073C>A
NC_000020.11   g.45542073C>G
NC_000020.11   g.45542073C>T
NC_000020.10   g.44170712C>A
NC_000020.10   g.44170712C>G
NC_000020.10   g.44170712C>T
NM_020398.3   c.*71G>T
NM_020398.3   c.*71G>C
NM_020398.3   c.*71G>A
NM_020398.4   c.*71G>T
NM_0  

rs153109

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000016.10   g.28507775T>C
NC_000016.9   g.28519096T>C|SEQ=[T/C]|GENE=IL27

Protein Summary

• Protein general information: Q07352  
  • Name: mRNA decay activator protein ZFP36L1 (Butyrate response factor 1) (EGF response factor 1) (ERF 1) (TPA induced sequence 11b) (Zinc finger protein 36, C3H1 type like 1) (ZFP36 like 1)
  • Length: 338  
  • Mass: 36314
  • Tissue specificity: Expressed mainly in the basal epidermal layer, weakly in the suprabasal epidermal layers (PubMed
• Sequence:

  MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEP
  APALSSRDSRFRDRSFSEGGERLLPTQKQPGGGQVNSSRYKTELCRPFEENGACKYGDKCQFAHGIHELRSLTRH
  PKYKTELCRTFHTIGFCPYGPRCHFIHNAEERRALAGARDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTS
  ITPPPILSADDLLGSPTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLS
  DQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD

• Structural information:
  • Interpro: IPR007635  IPR000571  IPR036855  
  • Prosite: PS50103
  • PDB: 1W0V 1W0W
  • PDBsum: 1W0V 1W0W
  • STRING: ENSP00000388402
• Other Databases: GeneCards:  ZFP36L1  Malacards:  ZFP36L1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0043488	regulation of mRNA stability	IDA	biological process
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0043488	regulation of mRNA stability	IDA	biological process
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0071320	cellular response to cAMP	IDA	biological process
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0043488	regulation of mRNA stability	IDA	biological process
GO:0043488	regulation of mRNA stability	IDA	biological process
GO:0071356	cellular response to tumor necrosis factor	IDA	biological process
GO:0071560	cellular response to transforming growth factor beta stimulus	IDA	biological process
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0043488	regulation of mRNA stability	IDA	biological process
GO:0009611	response to wounding	IDA	biological process
GO:0071889	14-3-3 protein binding	IDA	molecular function
GO:0043488	regulation of mRNA stability	IDA	biological process
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0000932	P-body	IDA	cellular component
GO:0043488	regulation of mRNA stability	IDA	biological process
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0070371	ERK1 and ERK2 cascade	IDA	biological process
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0043488	regulation of mRNA stability	IDA	biological process
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0045657	positive regulation of monocyte differentiation	IDA	biological process
GO:0032869	cellular response to insulin stimulus	IDA	biological process
GO:0014065	phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0071889	14-3-3 protein binding	IDA	molecular function
GO:0061158	3'-UTR-mediated mRNA destabilization	IDA	biological process
GO:0061158	3'-UTR-mediated mRNA destabilization	IDA	biological process
GO:0071375	cellular response to peptide hormone stimulus	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0010468	regulation of gene expression	IDA	biological process
GO:0000165	MAPK cascade	IDA	biological process
GO:0071385	cellular response to glucocorticoid stimulus	IDA	biological process
GO:0071364	cellular response to epidermal growth factor stimulus	IDA	biological process
GO:0061158	3'-UTR-mediated mRNA destabilization	IDA	biological process
GO:0061158	3'-UTR-mediated mRNA destabilization	IDA	biological process
GO:0000165	MAPK cascade	IDA	biological process
GO:0045647	negative regulation of erythrocyte differentiation	IDA	biological process
GO:0071375	cellular response to peptide hormone stimulus	IDA	biological process
GO:0061158	3'-UTR-mediated mRNA destabilization	IDA	biological process
GO:0061158	3'-UTR-mediated mRNA destabilization	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0031440	regulation of mRNA 3'-end processing	IDA	biological process
GO:0061158	3'-UTR-mediated mRNA destabilization	IDA	biological process
GO:0097403	cellular response to raffinose	ISS	biological process
GO:0071472	cellular response to salt stress	ISS	biological process
GO:0038066	p38MAPK cascade	ISS	biological process
GO:0045600	positive regulation of fat cell differentiation	ISS	biological process
GO:0043491	protein kinase B signaling	ISS	biological process
GO:0043488	regulation of mRNA stability	IMP	biological process
GO:0043488	regulation of mRNA stability	IMP	biological process
GO:1902172	regulation of keratinocyte apoptotic process	IMP	biological process
GO:0045616	regulation of keratinocyte differentiation	IMP	biological process
GO:0051028	mRNA transport	IMP	biological process
GO:1904582	positive regulation of intracellular mRNA localization	IMP	biological process
GO:0048382	mesendoderm development	ISS	biological process
GO:0044344	cellular response to fibroblast growth factor stimulus	ISS	biological process
GO:0071456	cellular response to hypoxia	IMP	biological process
GO:0061158	3'-UTR-mediated mRNA destabilization	IMP	biological process
GO:0045661	regulation of myoblast differentiation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0010837	regulation of keratinocyte proliferation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0072091	regulation of stem cell proliferation	ISS	biological process
GO:0061158	3'-UTR-mediated mRNA destabilization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0061158	3'-UTR-mediated mRNA destabilization	IMP	biological process
GO:0033077	T cell differentiation in thymus	ISS	biological process
GO:0031086	nuclear-transcribed mRNA catabolic process, deadenylation-independent decay	ISS	biological process
GO:1901991	negative regulation of mitotic cell cycle phase transition	ISS	biological process
GO:0045577	regulation of B cell differentiation	ISS	biological process
GO:1900153	positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	ISS	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0051028	mRNA transport	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	NAS	molecular function
GO:0043488	regulation of mRNA stability	IDA	biological process
GO:0003729	mRNA binding	IDA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043488	regulation of mRNA stability	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1990904	ribonucleoprotein complex	IEA	cellular component
GO:0097403	cellular response to raffinose	IEA	biological process
GO:0071472	cellular response to salt stress	IEA	biological process
GO:0071320	cellular response to cAMP	IEA	biological process
GO:0048382	mesendoderm development	IEA	biological process
GO:0045600	positive regulation of fat cell differentiation	IEA	biological process
GO:0044344	cellular response to fibroblast growth factor stimulus	IEA	biological process
GO:0043491	protein kinase B signaling	IEA	biological process
GO:0043488	regulation of mRNA stability	IEA	biological process
GO:0038066	p38MAPK cascade	IEA	biological process
GO:0035925	mRNA 3'-UTR AU-rich region binding	IEA	molecular function
GO:0021915	neural tube development	IEA	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0003729	mRNA binding	IEA	molecular function
GO:0003342	proepicardium development	IEA	biological process
GO:0001570	vasculogenesis	IEA	biological process
GO:0000288	nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	IEA	biological process
GO:0043488	regulation of mRNA stability	IEA	biological process
GO:0035925	mRNA 3'-UTR AU-rich region binding	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0003729	mRNA binding	IEA	molecular function
GO:1901991	negative regulation of mitotic cell cycle phase transition	IEA	biological process
GO:0072091	regulation of stem cell proliferation	IEA	biological process
GO:0071375	cellular response to peptide hormone stimulus	IEA	biological process
GO:0061158	3'-UTR-mediated mRNA destabilization	IEA	biological process
GO:0060712	spongiotrophoblast layer development	IEA	biological process
GO:0060710	chorio-allantoic fusion	IEA	biological process
GO:0048568	embryonic organ development	IEA	biological process
GO:0045661	regulation of myoblast differentiation	IEA	biological process
GO:0045577	regulation of B cell differentiation	IEA	biological process
GO:0035264	multicellular organism growth	IEA	biological process
GO:0033077	T cell differentiation in thymus	IEA	biological process
GO:0008283	cell population proliferation	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000165	MAPK cascade	IEA	biological process
GO:1900153	positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	IEA	biological process
GO:0031086	nuclear-transcribed mRNA catabolic process, deadenylation-independent decay	IEA	biological process
GO:0006402	mRNA catabolic process	IEA	biological process
GO:0000932	P-body	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04218	Cellular senescence

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray