• Gene id: 6767

Gene Summary

• Gene Symbol: ST13   Gene   UCSC   Ensembl
• Aliases: AAG2, FAM10A1, FAM10A4, HIP, HOP, HSPABP, HSPABP1, P48, PRO0786, SNC6
• Gene name: ST13 Hsp70 interacting protein
• Alternate names: hsc70-interacting protein, Hsp70-interacting protein, aging-associated protein 2, heat shock 70kD protein binding protein, progesterone receptor-associated p48 protein, putative tumor suppressor ST13, renal carcinoma antigen NY-REN-33, suppression of tumorigenic,
• Gene location: 22q13.2 (40857007: 40824534)     Exons: 12     NC_000022.11
• Gene summary(Entrez): The protein encoded by this gene is an adaptor protein that mediates the association of the heat shock proteins HSP70 and HSP90. This protein has been shown to be involved in the assembly process of glucocorticoid receptor, which requires the assistance o
• OMIM: 606796

Protein Summary

• Protein general information: P50502  
  • Name: Hsc70 interacting protein (Hip) (Aging associated protein 2) (Progesterone receptor associated p48 protein) (Protein FAM10A1) (Putative tumor suppressor ST13) (Renal carcinoma antigen NY REN 33) (Suppression of tumorigenicity 13 protein)
  • Length: 369  
  • Mass: 41332
• Sequence:

  MDPRKVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPPATQKAKSEENTKEEKPDSKKVEEDLKADEPS
  SEESDLEIDKEGVIEPDTDAPQEMGDENAEITEEMMDQANDKKVAAIEALNDGELQKAIDLFTDAIKLNPRLAIL
  YAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLKEVQ
  PRAQKIAEHRRKYERKREEREIKERIERVKKAREEHERAQREEEARRQSGAQYGSFPGGFPGGMPGNFPGGMPGM
  GGGMPGMAGMPGLNEILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKYQSNPKVMNLISKLSAKFGGQA

• Structural information:
  • Protein Domains: (319..35-)
    (/note="STI1"-)
  • Interpro: IPR034649  IPR041243  IPR006636  IPR013026  IPR011990   IPR019734  
  • Prosite: PS50005 PS50293
  • CDD: cd14438
  • PDB: 1UZS
  • PDBsum: 1UZS
  • STRING: ENSP00000216218
• Other Databases: GeneCards:  ST13  Malacards:  ST13

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061077	chaperone-mediated protein folding	IBA	biological process
GO:0051085	chaperone cofactor-dependent protein refolding	IBA	biological process
GO:0065003	protein-containing complex assembly	IBA	biological process
GO:0031072	heat shock protein binding	IBA	molecular function
GO:0046983	protein dimerization activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0030674	protein-macromolecule adaptor activity	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0032991	protein-containing complex	IEA	cellular component
GO:0051082	unfolded protein binding	IEA	molecular function
GO:0051085	chaperone cofactor-dependent protein refolding	IEA	biological process
GO:0009617	response to bacterium	IEA	biological process
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0030544	Hsp70 protein binding	IEA	molecular function
GO:0032564	dATP binding	IEA	molecular function
GO:0042802	identical protein binding	IEA	molecular function
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0051087	chaperone binding	IEA	molecular function
GO:0061084	negative regulation of protein refolding	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881