• Gene id: 6755

Gene Summary

• Gene Symbol: SSTR5   Gene   UCSC   Ensembl
• Aliases: SS-5-R
• Gene name: somatostatin receptor 5
• Alternate names: somatostatin receptor type 5, somatostatin receptor subtype 5,
• Gene location: 16p13.3 (1072755: 1081453)     Exons: 2     NC_000016.10
• Gene summary(Entrez): Somatostatin and its related peptide cortistatin exert multiple biological actions on normal and tumoral tissue targets by interacting with somatostatin receptors (SSTRs). The protein encoded by this gene is one of the SSTRs, which is a multi-pass membran
• OMIM: 601511

Protein Summary

• Protein general information: P35346  
  • Name: Somatostatin receptor type 5 (SS 5 R) (SS5 R) (SS5R)
  • Length: 364  
  • Mass: 39202
  • Tissue specificity: Adult pituitary gland, heart, small intestine, adrenal gland, cerebellum and fetal hypothalamus. No expression in fetal or adult kidney, liver, pancreas, uterus, spleen, lung, thyroid or ovary. {ECO
• Sequence:

  MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAKMKTVT
  NIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAVVHPLSSARW
  RRPRVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIV
  VKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCAN
  PVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000586  IPR001184  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000293897
• Other Databases: GeneCards:  SSTR5  Malacards:  SSTR5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071385	cellular response to glucocorticoid stimulus	IBA	biological process
GO:0050796	regulation of insulin secretion	IBA	biological process
GO:0042923	neuropeptide binding	IBA	molecular function
GO:0042277	peptide binding	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0043005	neuron projection	IBA	cellular component
GO:0007218	neuropeptide signaling pathway	IBA	biological process
GO:0004994	somatostatin receptor activity	IBA	molecular function
GO:0004994	somatostatin receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004994	somatostatin receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0042593	glucose homeostasis	IEA	biological process
GO:0050796	regulation of insulin secretion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0038170	somatostatin signaling pathway	IEA	biological process
GO:0038170	somatostatin signaling pathway	IEA	biological process
GO:0038170	somatostatin signaling pathway	IEA	biological process
GO:0032467	positive regulation of cytokinesis	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04024	cAMP signaling pathway
hsa04935	Growth hormone synthesis, secretion and action

Diseases

Associated diseases	References
Bipolar disorder	PMID:12192619
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq