• Gene id: 6754

Gene Summary

• Gene Symbol: SSTR4   Gene   UCSC   Ensembl
• Aliases: SS-4-R, SS4-R, SS4R
• Gene name: somatostatin receptor 4
• Alternate names: somatostatin receptor type 4, G-protein coupled receptor,
• Gene location: 20p11.21 (23035311: 23039236)     Exons: 1     NC_000020.11
• Gene summary(Entrez): Somatostatin acts at many sites to inhibit the release of many hormones and other secretory proteins. The biologic effects of somatostatin are probably mediated by a family of G protein-coupled receptors that are expressed in a tissue-specific manner. S
• OMIM: 146770

Protein Summary

• Protein general information: P31391  
  • Name: Somatostatin receptor type 4 (SS 4 R) (SS4 R) (SS4R)
  • Length: 388  
  • Mass: 42003
  • Tissue specificity: Specifically expressed in fetal and adult brain, lung tissue, stomach, and in lesser quantities in the kidney, pituitary and adrenals.
• Sequence:

  MSAPSTLPPGGEEGLGTAWPSAANASSAPAEAEEAVAGPGDARAAGMVAIQCIYALVCLVGLVGNALVIFVILRY
  AKMKTATNIYLLNLAVADELFMLSVPFVASSAALRHWPFGSVLCRAVLSVDGLNMFTSVFCLTVLSVDRYVAVVH
  PLRAATYRRPSVAKLINLGVWLASLLVTLPIAIFADTRPARGGQAVACNLQWPHPAWSAVFVVYTFLLGFLLPVL
  AIGLCYLLIVGKMRAVALRAGWQQRRRSEKKITRLVLMVVVVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILS
  YANSCANPILYGFLSDNFRRFFQRVLCLRCCLLEGAGGAEEEPLDYYATALKSKGGAGCMCPPLPCQQEALQPEP
  GRKRIPLTRTTTF

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000586  IPR001512  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000255008
• Other Databases: GeneCards:  SSTR4  Malacards:  SSTR4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043005	neuron projection	IBA	cellular component
GO:0007218	neuropeptide signaling pathway	IBA	biological process
GO:0004994	somatostatin receptor activity	IBA	molecular function
GO:0071385	cellular response to glucocorticoid stimulus	IBA	biological process
GO:0042923	neuropeptide binding	IBA	molecular function
GO:0042277	peptide binding	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0004994	somatostatin receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0004994	somatostatin receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0004994	somatostatin receptor activity	IEA	molecular function
GO:0016477	cell migration	IEA	biological process
GO:0090238	positive regulation of arachidonic acid secretion	IEA	biological process
GO:0106072	negative regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0030900	forebrain development	IEA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0071385	cellular response to glucocorticoid stimulus	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0038170	somatostatin signaling pathway	IEA	biological process
GO:0038170	somatostatin signaling pathway	IEA	biological process
GO:0038170	somatostatin signaling pathway	IEA	biological process
GO:0038170	somatostatin signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq