• Gene id: 6753

Gene Summary

• Gene Symbol: SSTR3   Gene   UCSC   Ensembl
• Aliases: SS-3-R, SS3-R, SS3R, SSR-28
• Gene name: somatostatin receptor 3
• Alternate names: somatostatin receptor type 3,
• Gene location: 22q13.1 (37220450: 37204236)     Exons: 8     NC_000022.11
• Gene summary(Entrez): This gene encodes a member of the somatostatin receptor protein family. Somatostatins are peptide hormones that regulate diverse cellular functions such as neurotransmission, cell proliferation, and endocrine signaling as well as inhibiting the release of
• OMIM: 602550

Protein Summary

• Protein general information: P32745  
  • Name: Somatostatin receptor type 3 (SS 3 R) (SS3 R) (SS3R) (SSR 28)
  • Length: 418  
  • Mass: 45847
  • Tissue specificity: Brain, pituitary and pancreas. {ECO
• Sequence:

  MDMLHPSSVSTTSEPENASSAWPPDATLGNVSAGPSPAGLAVSGVLIPLVYLVVCVVGLLGNSLVIYVVLRHTAS
  PSVTNVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLVMAVDGINQFTSIFCLTVMSVDRYLAVVHPTR
  SARWRTAPVARTVSAAVWVASAVVVLPVVVFSGVPRGMSTCHMQWPEPAAAWRAGFIIYTAALGFFGPLLVICLC
  YLLIVVKVRSAGRRVWAPSCQRRRRSERRVTRMVVAVVALFVLCWMPFYVLNIVNVVCPLPEEPAFFGLYFLVVA
  LPYANSCANPILYGFLSYRFKQGFRRVLLRPSRRVRSQEPTVGPPEKTEEEDEEEEDGEESREGGKGKEMNGRVS
  QITQPGTSGQERPPSRVASKEQQLLPQEASTGEKSSTMRISYL

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000586  IPR001856  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000480971
• Other Databases: GeneCards:  SSTR3  Malacards:  SSTR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0042277	peptide binding	IBA	molecular function
GO:0042923	neuropeptide binding	IBA	molecular function
GO:0007218	neuropeptide signaling pathway	IBA	biological process
GO:0043005	neuron projection	IBA	cellular component
GO:0004994	somatostatin receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0004994	somatostatin receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0008628	hormone-mediated apoptotic signaling pathway	TAS	biological process
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0005929	cilium	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0060170	ciliary membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097731	9+0 non-motile cilium	IEA	cellular component
GO:0097730	non-motile cilium	IEA	cellular component
GO:0071392	cellular response to estradiol stimulus	IEA	biological process
GO:0042594	response to starvation	IEA	biological process
GO:0021549	cerebellum development	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0060170	ciliary membrane	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0071385	cellular response to glucocorticoid stimulus	IEA	biological process
GO:0030900	forebrain development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0097730	non-motile cilium	ISS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0038170	somatostatin signaling pathway	IEA	biological process
GO:0038170	somatostatin signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04935	Growth hormone synthesis, secretion and action

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq