• Gene id: 6750

Gene Summary

• Gene Symbol: SST   Gene   UCSC   Ensembl
• Aliases: SMST
• Gene name: somatostatin
• Alternate names: somatostatin, growth hormone release-inhibiting factor, prepro-somatostatin, somatostatin-14, somatostatin-28,
• Gene location: 3q27.3 (187670393: 187668911)     Exons: 2     NC_000003.12
• Gene summary(Entrez): The hormone somatostatin has active 14 aa and 28 aa forms that are produced by alternate cleavage of the single preproprotein encoded by this gene. Somatostatin is expressed throughout the body and inhibits the release of numerous secondary hormones by bi
• OMIM: 154870

Protein Summary

• Protein general information: P61278  
  • Name: Somatostatin (Growth hormone release inhibiting factor) [Cleaved into: Somatostatin 28; Somatostatin 14 (SST 14); Neuronostatin (NST)]
  • Length: 116  
  • Mass: 12736
• Sequence:

  MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQ
  AAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC

• Structural information:
  • Interpro: IPR004250  IPR018142  
  • PDB: 1P2W 2MI1
  • PDBsum: 1P2W 2MI1
  • STRING: ENSP00000287641
• Other Databases: GeneCards:  SST  Malacards:  SST

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030334	regulation of cell migration	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0030334	regulation of cell migration	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0048545	response to steroid hormone	IEA	biological process
GO:0010447	response to acidic pH	IEA	biological process
GO:0010243	response to organonitrogen compound	IEA	biological process
GO:0009408	response to heat	IEA	biological process
GO:0006972	hyperosmotic response	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0043200	response to amino acid	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0042493	response to drug	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0007586	digestion	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0008628	hormone-mediated apoptotic signaling pathway	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0005179	hormone activity	TAS	molecular function
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0007584	response to nutrient	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04024	cAMP signaling pathway
hsa04935	Growth hormone synthesis, secretion and action
hsa04971	Gastric acid secretion

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881