• Gene id: 6748

Gene Summary

• Gene Symbol: SSR4   Gene   UCSC   Ensembl
• Aliases: CDG1Y, TRAPD
• Gene name: signal sequence receptor subunit 4
• Alternate names: translocon-associated protein subunit delta, SSR-delta, TRAP-delta, signal sequence receptor, delta,
• Gene location: Xq28 (153794158: 153798511)     Exons: 6     NC_000023.11
• Gene summary(Entrez): This gene encodes the delta subunit of the translocon-associated protein complex which is involved in translocating proteins across the endoplasmic reticulum membrane. The encoded protein is located in the Xq28 region and is arranged in a compact head-to-
• OMIM: 300090

Protein Summary

• Protein general information: P51571  
  • Name: Translocon associated protein subunit delta (TRAP delta) (Signal sequence receptor subunit delta) (SSR delta)
  • Length: 173  
  • Mass: 18999
• Sequence:

  MAAMASLGALALLLLSSLSRCSAEACLEPQITPSYYTTSDAVISTETVFIVEISLTCKNRVQNMALYADVGGKQF
  PVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQRNNEDISIIPPLFTVSVDHRGTWNGPWVSTE
  VLAAAIGLVIYYLAFSAKSHIQA

• Structural information:
  • Interpro: IPR008855  
  • STRING: ENSP00000317331
• Other Databases: GeneCards:  SSR4  Malacards:  SSR4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0012505	endomembrane system	IBA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005784	Sec61 translocon complex	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005784	Sec61 translocon complex	NAS	cellular component
GO:0005784	Sec61 translocon complex	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum

Diseases

Associated diseases	References
Congenital disorders of glycosylation type I	KEGG:H00118
Congenital disorders of glycosylation type I	KEGG:H00118
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)