• Gene id: 6747

Gene Summary

• Gene Symbol: SSR3   Gene   UCSC   Ensembl
• Aliases: TRAPG
• Gene name: signal sequence receptor subunit 3
• Alternate names: translocon-associated protein subunit gamma, SSR gamma, TRAP-complex gamma subunit, TRAP-gamma, signal sequence receptor subunit gamma, signal sequence receptor, gamma (translocon-associated protein gamma), translocon-associated protein gamma subunit,
• Gene location: 3q25.31 (156555199: 156539552)     Exons: 5     NC_000003.12
• Gene summary(Entrez): The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR is comprised of four membrane proteins/subunits: alpha, beta, gamma, and delta. The fir
• OMIM: 606213

Protein Summary

• Protein general information: Q9UNL2  
  • Name: Translocon associated protein subunit gamma (TRAP gamma) (Signal sequence receptor subunit gamma) (SSR gamma)
  • Length: 185  
  • Mass: 21080
• Sequence:

  MAPKGSSKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAVLYSVMTLVSTYLVAF
  AYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVVVI
  VASFFILKNFNPTVNYILSISASSGLIALLSTGSK

• Structural information:
  • Interpro: IPR009779  
  • STRING: ENSP00000265044
• Other Databases: GeneCards:  SSR3  Malacards:  SSR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0006614	SRP-dependent cotranslational protein targeting to membrane	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881