• Gene id: 6746

Gene Summary

• Gene Symbol: SSR2   Gene   UCSC   Ensembl
• Aliases: HSD25, TLAP, TRAP-BETA, TRAPB
• Gene name: signal sequence receptor subunit 2
• Alternate names: translocon-associated protein subunit beta, SSR-beta, signal sequence receptor subunit beta, signal sequence receptor, beta (translocon-associated protein beta), translocon-associated protein beta,
• Gene location: 1q22 (156020950: 156009047)     Exons: 6     NC_000001.11
• Gene summary(Entrez): The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein (alpha-SSR or SSR1) and a 22-kD glycoprote
• OMIM: 600867

Protein Summary

• Protein general information: P43308  
  • Name: Translocon associated protein subunit beta (TRAP beta) (Signal sequence receptor subunit beta) (SSR beta)
  • Length: 183  
  • Mass: 20135
• Sequence:

  MRLLSFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELSDDSFPPEDFGIVSGM
  LNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRFSPHFLDW
  AAFGVMTLPSIGIPLLLWYSSKRKYDTPKTKKN

• Structural information:
  • Interpro: IPR008856  
  • DIP: 60652
  • STRING: ENSP00000295702
• Other Databases: GeneCards:  SSR2  Malacards:  SSR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006613	cotranslational protein targeting to membrane	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0001701	in utero embryonic development	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)