• Gene id: 6745

Gene Summary

• Gene Symbol: SSR1   Gene   UCSC   Ensembl
• Aliases: TRAPA
• Gene name: signal sequence receptor subunit 1
• Alternate names: translocon-associated protein subunit alpha, SSR alpha subunit, SSR-alpha, TRAP alpha, signal sequence receptor subunit alpha, signal sequence receptor, alpha, translocon-associated protein alpha subunit,
• Gene location: 6p24.3 (7313198: 7281142)     Exons: 8     NC_000006.12
• Gene summary(Entrez): The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein encoded by this gene and a 22-kD glycoprot
• OMIM: 600868

Protein Summary

• Protein general information: P43307  
  • Name: Translocon associated protein subunit alpha (TRAP alpha) (Signal sequence receptor subunit alpha) (SSR alpha)
  • Length: 286  
  • Mass: 32235
• Sequence:

  MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVEDSIIEDEDDEAEVEEDEPTDLVEDKEEEDVSG
  EPEASPSADTTILFVKGEDFPANNIVKFLVGFTNKGTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQR
  QATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIEREDGLDGETIFMYMFLAGLGLLVIVGL
  HQLLESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSVGSDE

• Structural information:
  • Interpro: IPR005595  
  • STRING: ENSP00000244763
• Other Databases: GeneCards:  SSR1  Malacards:  SSR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006613	cotranslational protein targeting to membrane	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0036498	IRE1-mediated unfolded protein response	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881