• Gene id: 6742

Gene Summary

• Gene Symbol: SSBP1   Gene   UCSC   Ensembl
• Aliases: Mt-SSB, SOSS-B1, SSBP, mtSSB
• Gene name: single stranded DNA binding protein 1
• Alternate names: single-stranded DNA-binding protein, mitochondrial, PWP1-interacting protein 17, single-stranded DNA binding protein 1, mitochondrial,
• Gene location: 7q34 (52008229: 51991331)     Exons: 8     NC_000019.10
• Gene summary(Entrez): SSBP1 is a housekeeping gene involved in mitochondrial biogenesis (Tiranti et al., 1995 [PubMed 7789991]). It is also a subunit of a single-stranded DNA (ssDNA)-binding complex involved in the maintenance of genome stability (Huang et al., 2009) [PubMed 1
• OMIM: 600439

Protein Summary

• Protein general information: Q04837  
  • Name: Single stranded DNA binding protein, mitochondrial (Mt SSB) (MtSSB) (PWP1 interacting protein 17)
  • Length: 148  
  • Mass: 17260
• Sequence:

  MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQL
  GDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKEKE

• Structural information:
  • Protein Domains: (30..14-)
    (/note="SSB"-)
  • Interpro: IPR012340  IPR000424  IPR011344  
  • Prosite: PS50935
  • CDD: cd04496
  • PDB: 1S3O 2DUD 3ULL
  • PDBsum: 1S3O 2DUD 3ULL
  • STRING: ENSP00000419665
• Other Databases: GeneCards:  SSBP1  Malacards:  SSBP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009295	nucleoid	IBA	cellular component
GO:0042645	mitochondrial nucleoid	IBA	cellular component
GO:0003697	single-stranded DNA binding	IBA	molecular function
GO:0005739	mitochondrion	IBA	cellular component
GO:0006264	mitochondrial DNA replication	IBA	biological process
GO:0051096	positive regulation of helicase activity	IBA	biological process
GO:0003682	chromatin binding	IDA	molecular function
GO:0051096	positive regulation of helicase activity	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006260	DNA replication	IEA	biological process
GO:0003697	single-stranded DNA binding	IEA	molecular function
GO:0042645	mitochondrial nucleoid	IEA	cellular component
GO:0006260	DNA replication	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0003697	single-stranded DNA binding	IDA	molecular function
GO:0006268	DNA unwinding involved in DNA replication	IDA	biological process
GO:1905776	positive regulation of DNA helicase activity	IDA	biological process
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0007005	mitochondrion organization	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070584	mitochondrion morphogenesis	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0042645	mitochondrial nucleoid	IDA	cellular component
GO:0042645	mitochondrial nucleoid	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005634	nucleus	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03440	Homologous recombination
hsa03030	DNA replication
hsa03430	Mismatch repair

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq