• Gene id: 6741

Gene Summary

• Gene Symbol: SSB   Gene   UCSC   Ensembl
• Aliases: LARP3, La, La/SSB
• Gene name: small RNA binding exonuclease protection factor La
• Alternate names: lupus La protein, La ribonucleoprotein domain family, member 3, SS-B, SS-B/La protein, Sjogren syndrome antigen B, autoantigen La, la autoantigen, lupus La antigen, sjoegren syndrome type B antigen,
• Gene location: 2q31.1 (169798870: 169812063)     Exons: 13     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is involved in diverse aspects of RNA metabolism, including binding and protecting poly(U) termini of nascent RNA polymerase III transcripts from exonuclease digestion, processing 5' and 3' ends of pre-tRNA precursors, act
• OMIM: 109090

Protein Summary

• Protein general information: P05455  
  • Name: Lupus La protein (La autoantigen) (La ribonucleoprotein) (Sjoegren syndrome type B antigen) (SS B)
  • Length: 408  
  • Mass: 46837
• Sequence:

  MAENGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKS
  KAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAF
  KGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKKNEERKQNKVEAKLRAKQEQEAKQKLEEDAEMKS
  LEEKIGCLLKFSGDLDDQTCREDLHILFSNHGEIKWIDFVRGAKEGIILFKEKAKEALGKAKDANNGNLQLRNKE
  VTWEVLEGEVEKEALKKIIEDQQESLNKWKSKGRRFKGKGKGNKAAQPGSGKGKVQFQGKKTKFASDDEHDEHDE
  NGATGPVKRAREETDKEEPASKQQKTENGAGDQ

• Structural information:
  • Protein Domains: (7..9-)
    RNA-binding (/note="HTH-La-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00332-)
    (111..18-)
    (/note="RRM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR006630  IPR014886  IPR002344  IPR012677  IPR035979   IPR000504  IPR036388  IPR036390  
  • Prosite: PS50961 PS50102
  • PDB: 1OWX 1S79 1S7A 1YTY 1ZH5 2VOD 2VON 2VOO 2VOP
  • PDBsum: 1OWX 1S79 1S7A 1YTY 1ZH5 2VOD 2VON 2VOO 2VOP
  • DIP: 29750
  • STRING: ENSP00000386636
• Other Databases: GeneCards:  SSB  Malacards:  SSB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0075522	IRES-dependent viral translational initiation	IDA	biological process
GO:0006396	RNA processing	IEA	biological process
GO:1990904	ribonucleoprotein complex	IEA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000049	tRNA binding	TAS	molecular function
GO:0003729	mRNA binding	TAS	molecular function
GO:0006400	tRNA modification	TAS	biological process
GO:0008334	histone mRNA metabolic process	TAS	biological process
GO:1990904	ribonucleoprotein complex	TAS	cellular component
GO:1903608	protein localization to cytoplasmic stress granule	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0000784	nuclear chromosome, telomeric region	HDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0008033	tRNA processing	IMP	biological process
GO:0000049	tRNA binding	IMP	molecular function
GO:0003723	RNA binding	IMP	molecular function
GO:0006409	tRNA export from nucleus	IMP	biological process
GO:0042780	tRNA 3'-end processing	IGI	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:1990825	sequence-specific mRNA binding	IMP	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0001682	tRNA 5'-leader removal	IGI	biological process
GO:0071045	nuclear histone mRNA catabolic process	IMP	biological process
GO:0008266	poly(U) RNA binding	IMP	molecular function
GO:0008266	poly(U) RNA binding	IMP	molecular function
GO:0008266	poly(U) RNA binding	IMP	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05322	Systemic lupus erythematosus

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)