• Gene id: 6734

Gene Summary

• Gene Symbol: SRPRA   Gene   UCSC   Ensembl
• Aliases: DP, SRPR, Sralpha
• Gene name: SRP receptor subunit alpha
• Alternate names: signal recognition particle receptor subunit alpha, DP-alpha, SR-alpha, SRP receptor alpha subunit, SRP-alpha, docking protein alpha, signal recognition particle receptor (docking protein),
• Gene location: 11q24.2 (121566882: 121785529)     Exons: 29     NC_000009.12
• Gene summary(Entrez): The gene encodes a subunit of the endoplasmic reticulum signal recognition particle receptor that, in conjunction with the signal recognition particle, is involved in the targeting and translocation of signal sequence tagged secretory and membrane protein
• OMIM: 182180

Protein Summary

• Protein general information: P08240  
  • Name: Signal recognition particle receptor subunit alpha (SR alpha) (Docking protein alpha) (DP alpha)
  • Length: 638  
  • Mass: 69811
• Sequence:

  MLDFFTIFSKGGLVLWCFQGVSDSCTGPVNALIRSVLLQERGGNNSFTHEALTLKYKLDNQFELVFVVGFQKILT
  LTYVDKLIDDVHRLFRDKYRTEIQQQSALSLLNGTFDFQNDFLRLLREAEESSKIRAPTTMKKFEDSEKAKKPVR
  SMIETRGEKPKEKAKNSKKKGAKKEGSDGPLATSKPVPAEKSGLPVGPENGVELSKEELIRRKREEFIQKHGRGM
  EKSNKSTKSDAPKEKGKKAPRVWELGGCANKEVLDYSTPTTNGTPEAALSEDINLIRGTGSGGQLQDLDCSSSDD
  EGAAQNSTKPSATKGTLGGMFGMLKGLVGSKSLSREDMESVLDKMRDHLIAKNVAADIAVQLCESVANKLEGKVM
  GTFSTVTSTVKQALQESLVQILQPQRRVDMLRDIMDAQRRQRPYVVTFCGVNGVGKSTNLAKISFWLLENGFSVL
  IAACDTFRAGAVEQLRTHTRRLSALHPPEKHGGRTMVQLFEKGYGKDAAGIAMEAIAFARNQGFDVVLVDTAGRM
  QDNAPLMTALAKLITVNTPDLVLFVGEALVGNEAVDQLVKFNRALADHSMAQTPRLIDGIVLTKFDTIDDKVGAA
  ISMTYITSKPIVFVGTGQTYCDLRSLNAKAVVAALMKA

• Structural information:
  • Interpro: IPR003593  IPR011012  IPR027417  IPR007222  IPR013822   IPR036225  IPR000897  IPR042101  
  • Prosite: PS00300
  • PDB: 2FH5 2GO5 5L3Q
  • PDBsum: 2FH5 2GO5 5L3Q
  • STRING: ENSP00000328023
• Other Databases: GeneCards:  SRPRA  Malacards:  SRPRA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003924	GTPase activity	IBA	molecular function
GO:0005047	signal recognition particle binding	IBA	molecular function
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0006605	protein targeting	IBA	biological process
GO:0016020	membrane	IBA	cellular component
GO:0045047	protein targeting to ER	IBA	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0003924	GTPase activity	IEA	molecular function
GO:0005047	signal recognition particle binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0006614	SRP-dependent cotranslational protein targeting to membrane	IEA	biological process
GO:0005785	signal recognition particle receptor complex	IEA	cellular component
GO:0006886	intracellular protein transport	IEA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0006613	cotranslational protein targeting to membrane	TAS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0036498	IRE1-mediated unfolded protein response	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03060	Protein export

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)