• Gene id: 6733

Gene Summary

• Gene Symbol: SRPK2   Gene   UCSC   Ensembl
• Aliases: SFRSK2
• Gene name: SRSF protein kinase 2
• Alternate names: SRSF protein kinase 2, SFRS protein kinase 2, SR protein kinase 2, SR-protein-specific kinase 2, serine kinase SRPK2, serine/arginine-rich protein-specific kinase 2, serine/arginine-rich splicing factor kinase 2, serine/threonine-protein kinase SRPK2,
• Gene location: 7q22.3 (105399362: 105110707)     Exons: 25     NC_000007.14
• OMIM: 602980

Protein Summary

• Protein general information: P78362  
  • Name: SRSF protein kinase 2 (EC 2.7.11.1) (SFRS protein kinase 2) (Serine/arginine rich protein specific kinase 2) (SR protein specific kinase 2) [Cleaved into: SRSF protein kinase 2 N terminal; SRSF protein kinase 2 C terminal]
  • Length: 688  
  • Mass: 77527
  • Tissue specificity: Highly expressed in brain, moderately expressed in heart and skeletal muscle and at low levels in lung, liver, and kidney. {ECO
• Sequence:

  MSVNSEKSSSSERPEPQQKAPLVPPPPPPPPPPPPPLPDPTPPEPEEEILGSDDEEQEDPADYCKGGYHPVKIGD
  LFNGRYHVIRKLGWGHFSTVWLCWDMQGKRFVAMKVVKSAQHYTETALDEIKLLKCVRESDPSDPNKDMVVQLID
  DFKISGMNGIHVCMVFEVLGHHLLKWIIKSNYQGLPVRCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILMCVD
  DAYVRRMAAEATEWQKAGAPPPSGSAVSTAPQQKPIGKISKNKKKKLKKKQKRQAELLEKRLQEIEELEREAERK
  IIEENITSAAPSNDQDGEYCPEVKLKTTGLEEAAEAETAKDNGEAEDQEEKEDAEKENIEKDEDDVDQELANIDP
  TWIESPKTNGHIENGPFSLEQQLDDEDDDEEDCPNPEEYNLDEPNAESDYTYSSSYEQFNGELPNGRHKIPESQF
  PEFSTSLFSGSLEPVACGSVLSEGSPLTEQEESSPSHDRSRTVSASSTGDLPKAKTRAADLLVNPLDPRNADKIR
  VKIADLGNACWVHKHFTEDIQTRQYRSIEVLIGAGYSTPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIA
  HIIELLGSIPRHFALSGKYSREFFNRRGELRHITKLKPWSLFDVLVEKYGWPHEDAAQFTDFLIPMLEMVPEKRA
  SAGECLRHPWLNS

• Structural information:
  • Protein Domains: (81..68-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 2X7G 5MYV
  • PDBsum: 2X7G 5MYV
  • STRING: ENSP00000377262
• Other Databases: GeneCards:  SRPK2  Malacards:  SRPK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004674	protein serine/threonine kinase activity	IGI	molecular function
GO:0018105	peptidyl-serine phosphorylation	IGI	biological process
GO:0004707	MAP kinase activity	IBA	molecular function
GO:0050684	regulation of mRNA processing	IBA	biological process
GO:0000245	spliceosomal complex assembly	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0010468	regulation of gene expression	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0048024	regulation of mRNA splicing, via spliceosome	TAS	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0008380	RNA splicing	IEA	biological process
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071889	14-3-3 protein binding	ISS	molecular function
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0045070	positive regulation of viral genome replication	IDA	biological process
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:0045087	innate immune response	IC	biological process
GO:0001525	angiogenesis	ISS	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0035063	nuclear speck organization	ISS	biological process
GO:0045787	positive regulation of cell cycle	ISS	biological process
GO:0043525	positive regulation of neuron apoptotic process	ISS	biological process
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0000165	MAPK cascade	IEA	biological process
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0008380	RNA splicing	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005524	ATP binding	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0000245	spliceosomal complex assembly	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0000785	chromatin	IDA	cellular component
GO:0062176	R-loop disassembly	IDA	biological process
GO:0016607	nuclear speck	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq