• Gene id: 6732

Gene Summary

• Gene Symbol: SRPK1   Gene   UCSC   Ensembl
• Aliases: SFRSK1
• Gene name: SRSF protein kinase 1
• Alternate names: SRSF protein kinase 1, SFRS protein kinase 1, SR-protein-specific kinase 1, serine/arginine-rich splicing factor kinase 1, serine/threonine-protein kinase SRPK1,
• Gene location: 6p21.31 (45339750: 45343972)     Exons: 8     NC_000001.11
• Gene summary(Entrez): This gene encodes a serine/arginine protein kinase specific for the SR (serine/arginine-rich domain) family of splicing factors. The protein localizes to the nucleus and the cytoplasm. It is thought to play a role in regulation of both constitutive and al
• OMIM: 601939

Protein Summary

• Protein general information: Q96SB4  
  • Name: SRSF protein kinase 1 (EC 2.7.11.1) (SFRS protein kinase 1) (Serine/arginine rich protein specific kinase 1) (SR protein specific kinase 1)
  • Length: 655  
  • Mass: 74325
  • Tissue specificity: Isoform 2 is predominantly expressed in the testis but is also present at lower levels in heart, ovary, small intestine, liver, kidney, pancreas and skeletal muscle. Isoform 1 is only seen in the testis, at lower levels than isoform 2.
• Sequence:

  MERKVLALQARKKRTKAKKDKAQRKSETQHRGSAPHSESDLPEQEEEILGSDDDEQEDPNDYCKGGYHLVKIGDL
  FNGRYHVIRKLGWGHFSTVWLSWDIQGKKFVAMKVVKSAEHYTETALDEIRLLKSVRNSDPNDPNREMVVQLLDD
  FKISGVNGTHICMVFEVLGHHLLKWIIKSNYQGLPLPCVKKIIQQVLQGLDYLHTKCRIIHTDIKPENILLSVNE
  QYIRRLAAEATEWQRSGAPPPSGSAVSTAPQPKPADKMSKNKKKKLKKKQKRQAELLEKRMQEIEEMEKESGPGQ
  KRPNKQEESESPVERPLKENPPNKMTQEKLEESSTIGQDQTLMERDTEGGAAEINCNGVIEVINYTQNSNNETLR
  HKEDLHNANDCDVQNLNQESSFLSSQNGDSSTSQETDSCTPITSEVSDTMVCQSSSTVGQSFSEQHISQLQESIR
  AEIPCEDEQEQEHNGPLDNKGKSTAGNFLVNPLEPKNAEKLKVKIADLGNACWVHKHFTEDIQTRQYRSLEVLIG
  SGYNTPADIWSTACMAFELATGDYLFEPHSGEEYTRDEDHIALIIELLGKVPRKLIVAGKYSKEFFTKKGDLKHI
  TKLKPWGLFEVLVEKYEWSQEEAAGFTDFLLPMLELIPEKRATAAECLRHPWLNS

• Structural information:
  • Protein Domains: (80..65-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 1WAK 1WBP 3BEG 4WUA 5MXX 5MY8 5NNG 5XV7 6FAD
  • PDBsum: 1WAK 1WBP 3BEG 4WUA 5MXX 5MY8 5NNG 5XV7 6FAD
  • DIP: 33888
  • STRING: ENSP00000362931
• Other Databases: GeneCards:  SRPK1  Malacards:  SRPK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000245	spliceosomal complex assembly	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0010468	regulation of gene expression	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0004707	MAP kinase activity	IBA	molecular function
GO:0050684	regulation of mRNA processing	IBA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0048024	regulation of mRNA splicing, via spliceosome	TAS	biological process
GO:0035092	sperm chromatin condensation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0008380	RNA splicing	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0007059	chromosome segregation	IEA	biological process
GO:0006397	mRNA processing	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0004672	protein kinase activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0008380	RNA splicing	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0050684	regulation of mRNA processing	IEA	biological process
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0045070	positive regulation of viral genome replication	IDA	biological process
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:0045087	innate immune response	IC	biological process
GO:0005654	nucleoplasm	IEA	cellular component
GO:0016363	nuclear matrix	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0000165	MAPK cascade	IEA	biological process
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0007059	chromosome segregation	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005524	ATP binding	IDA	molecular function
GO:0050684	regulation of mRNA processing	IDA	biological process
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0000785	chromatin	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R