• Gene id: 6729

Gene Summary

• Gene Symbol: SRP54   Gene   UCSC   Ensembl
• Aliases: SCN8
• Gene name: signal recognition particle 54
• Alternate names: signal recognition particle 54 kDa protein, signal recognition particle 54kD, signal recognition particle 54kDa,
• Gene location: 14q13.2 (34982897: 35029566)     Exons: 17     NC_000014.9
• OMIM: 604857

Protein Summary

• Protein general information: P61011  
  • Name: Signal recognition particle 54 kDa protein (SRP54)
  • Length: 504  
  • Mass: 55705
• Sequence:

  MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNKRKMI
  QHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQ
  NATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASI
  GQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDI
  EGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKL
  MTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNV
  SQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGMMGFNNM

• Structural information:
  • Interpro: IPR003593  IPR027417  IPR036891  IPR013822  IPR004125   IPR036225  IPR022941  IPR006325  IPR000897  IPR042101  
  • Prosite: PS00300
  • PDB: 1MFQ 1QB2 5L3Q
  • PDBsum: 1MFQ 1QB2 5L3Q
  • STRING: ENSP00000451818
• Other Databases: GeneCards:  SRP54  Malacards:  SRP54

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003924	GTPase activity	IBA	contributes to
GO:0005786	signal recognition particle, endoplasmic reticulum targeting	IBA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0008312	7S RNA binding	IBA	molecular function
GO:0006616	SRP-dependent cotranslational protein targeting to membrane, translocation	IBA	biological process
GO:0030942	endoplasmic reticulum signal peptide binding	IBA	molecular function
GO:0030851	granulocyte differentiation	IMP	biological process
GO:0003924	GTPase activity	IMP	molecular function
GO:0030593	neutrophil chemotaxis	ISS	biological process
GO:0031017	exocrine pancreas development	ISS	biological process
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0006614	SRP-dependent cotranslational protein targeting to membrane	IEA	biological process
GO:0008312	7S RNA binding	IEA	molecular function
GO:0048500	signal recognition particle	IEA	cellular component
GO:0005786	signal recognition particle, endoplasmic reticulum targeting	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0008312	7S RNA binding	IDA	molecular function
GO:0006614	SRP-dependent cotranslational protein targeting to membrane	IC	biological process
GO:0005730	nucleolus	IDA	NOT|cellular component
GO:0043021	ribonucleoprotein complex binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0006614	SRP-dependent cotranslational protein targeting to membrane	TAS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0008312	7S RNA binding	IDA	molecular function
GO:0003924	GTPase activity	IDA	contributes to
GO:0019003	GDP binding	IDA	molecular function
GO:0008312	7S RNA binding	IDA	molecular function
GO:0005786	signal recognition particle, endoplasmic reticulum targeting	IDA	cellular component
GO:0005525	GTP binding	IDA	molecular function
GO:0042493	response to drug	IDA	biological process
GO:0008144	drug binding	IDA	molecular function
GO:0030942	endoplasmic reticulum signal peptide binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0045047	protein targeting to ER	IMP	biological process
GO:0006616	SRP-dependent cotranslational protein targeting to membrane, translocation	ISS	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0006617	SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa03060	Protein export

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R