• Gene id: 6728

Gene Summary

• Gene Symbol: SRP19   Gene   UCSC   Ensembl
• Gene name: signal recognition particle 19
• Alternate names: signal recognition particle 19 kDa protein, signal recognition particle 19kD, signal recognition particle 19kDa,
• Gene location: 5q22.2 (112861187: 112898370)     Exons: 6     NC_000005.10
• OMIM: 182175

Protein Summary

• Protein general information: P09132  
  • Name: Signal recognition particle 19 kDa protein (SRP19)
  • Length: 144  
  • Mass: 16156
• Sequence:

  MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRD
  VQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK

• Structural information:
  • Interpro: IPR002778  IPR036521  
  • PDB: 1JID 1MFQ 1RY1 2J37 3KTV 4P3E 5M73
  • PDBsum: 1JID 1MFQ 1RY1 2J37 3KTV 4P3E 5M73
  • DIP: 41412
  • STRING: ENSP00000424870
• Other Databases: GeneCards:  SRP19  Malacards:  SRP19

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005786	signal recognition particle, endoplasmic reticulum targeting	IBA	cellular component
GO:0008312	7S RNA binding	IBA	molecular function
GO:0006617	SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition	IBA	biological process
GO:0006614	SRP-dependent cotranslational protein targeting to membrane	IEA	biological process
GO:0008312	7S RNA binding	IEA	molecular function
GO:0048500	signal recognition particle	IEA	cellular component
GO:0005786	signal recognition particle, endoplasmic reticulum targeting	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0006613	cotranslational protein targeting to membrane	TAS	biological process
GO:0005786	signal recognition particle, endoplasmic reticulum targeting	TAS	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006614	SRP-dependent cotranslational protein targeting to membrane	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0048500	signal recognition particle	IDA	cellular component
GO:0008312	7S RNA binding	IDA	molecular function
GO:0043022	ribosome binding	IDA	contributes to
GO:0005786	signal recognition particle, endoplasmic reticulum targeting	IDA	cellular component
GO:0008312	7S RNA binding	IDA	molecular function
GO:0042493	response to drug	IDA	biological process
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03060	Protein export

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)