• Gene id: 6727

Gene Summary

• Gene Symbol: SRP14   Gene   UCSC   Ensembl
• Aliases: ALURBP
• Gene name: signal recognition particle 14
• Alternate names: signal recognition particle 14 kDa protein, 18 kDa Alu RNA-binding protein, homologous Alu RNA binding protein,
• Gene location: 15q15.1 (152983578: 152970534)     Exons: 6     NC_000006.12
• OMIM: 600708

Protein Summary

• Protein general information: P37108  
  • Name: Signal recognition particle 14 kDa protein (SRP14) (18 kDa Alu RNA binding protein)
  • Length: 136  
  • Mass: 14570
• Sequence:

  MVLLESEQFLTELTRLFQKCRTSGSVYITLKKYDGRTKPIPKKGTVEGFEPADNKCLLRATDGKKKISTVVSSKE
  VNKFQMAYSNLLRANMDGLKKRDKKNKTKKTKAAAAAAAAAPAAAATAPTTAATTAATAAQ

• Structural information:
  • Interpro: IPR003210  IPR009018  
  • PDB: 1E8O 1E8S 1RY1 4UYJ 4UYK 5AOX
  • PDBsum: 1E8O 1E8S 1RY1 4UYJ 4UYK 5AOX
  • DIP: 6152
  • STRING: ENSP00000267884
• Other Databases: GeneCards:  SRP14  Malacards:  SRP14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045047	protein targeting to ER	IBA	biological process
GO:0005786	signal recognition particle, endoplasmic reticulum targeting	IBA	cellular component
GO:0005786	signal recognition particle, endoplasmic reticulum targeting	IEA	cellular component
GO:0006614	SRP-dependent cotranslational protein targeting to membrane	IEA	biological process
GO:0008312	7S RNA binding	IEA	molecular function
GO:0030942	endoplasmic reticulum signal peptide binding	IEA	molecular function
GO:0048500	signal recognition particle	IEA	cellular component
GO:0005786	signal recognition particle, endoplasmic reticulum targeting	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0008312	7S RNA binding	TAS	molecular function
GO:0003723	RNA binding	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0006613	cotranslational protein targeting to membrane	TAS	biological process
GO:0005786	signal recognition particle, endoplasmic reticulum targeting	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006614	SRP-dependent cotranslational protein targeting to membrane	TAS	biological process
GO:0034774	secretory granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005786	signal recognition particle, endoplasmic reticulum targeting	IDA	cellular component
GO:0042493	response to drug	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0045047	protein targeting to ER	IMP	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03060	Protein export

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray