• Gene id: 6726

Gene Summary

• Gene Symbol: SRP9   Gene   UCSC   Ensembl
• Aliases: ALURBP
• Gene name: signal recognition particle 9
• Alternate names: signal recognition particle 9 kDa protein, signal recognition particle 9kD, signal recognition particle 9kDa,
• Gene location: 1q42.12 (225777812: 225790465)     Exons: 4     NC_000001.11
• OMIM: 600707

Protein Summary

• Protein general information: P49458  
  • Name: Signal recognition particle 9 kDa protein (SRP9)
  • Length: 86  
  • Mass: 10112
• Sequence:

  MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLMRLMVA
  KEARNVTMETE

• Structural information:
  • Interpro: IPR008832  IPR009018  IPR039914  IPR039432  
  • PDB: 1E8O 1E8S 1RY1 4UYJ 4UYK 5AOX
  • PDBsum: 1E8O 1E8S 1RY1 4UYJ 4UYK 5AOX
  • DIP: 6151
  • STRING: ENSP00000305230
• Other Databases: GeneCards:  SRP9  Malacards:  SRP9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005786	signal recognition particle, endoplasmic reticulum targeting	IBA	cellular component
GO:0006614	SRP-dependent cotranslational protein targeting to membrane	IBA	biological process
GO:0006614	SRP-dependent cotranslational protein targeting to membrane	IEA	biological process
GO:0008312	7S RNA binding	IEA	molecular function
GO:0045900	negative regulation of translational elongation	IEA	biological process
GO:0048500	signal recognition particle	IEA	cellular component
GO:0005786	signal recognition particle, endoplasmic reticulum targeting	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	TAS	molecular function
GO:0005047	signal recognition particle binding	TAS	molecular function
GO:0005785	signal recognition particle receptor complex	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0006614	SRP-dependent cotranslational protein targeting to membrane	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005786	signal recognition particle, endoplasmic reticulum targeting	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03060	Protein export

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881