• Gene id: 6722

Gene Summary

• Gene Symbol: SRF   Gene   UCSC   Ensembl
• Aliases: MCM1
• Gene name: serum response factor
• Alternate names: serum response factor, c-fos serum response element-binding transcription factor, minichromosome maintenance 1 homolog,
• Gene location: 6p21.1 (43171268: 43181505)     Exons: 8     NC_000006.12
• Gene summary(Entrez): This gene encodes a ubiquitous nuclear protein that stimulates both cell proliferation and differentiation. It is a member of the MADS (MCM1, Agamous, Deficiens, and SRF) box superfamily of transcription factors. This protein binds to the serum response e
• OMIM: 300172

Protein Summary

• Protein general information: P11831  
  • Name: Serum response factor (SRF)
  • Length: 508  
  • Mass: 51593
• Sequence:

  MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREAAAAAATTPAPTAGAL
  YSGSEGDSESGEEEELGAERRGLKRSLSEMEIGMVVGGPEASAAATGGYGPVSGAVSGAKPGKKTRGRVKIKMEF
  IDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSP
  PRSDPTTDQRMSATGFEETDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPIT
  NYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPGGAVAQQVPVQAIQVHQAPQQASPSRDS
  STDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPTSGLGDGSLTVLNAFSQAPSTMQVSHSQVQE
  PGGVPQVFLTASSGTVQIPVSAVQLHQMAVIGQQAGSSSNLTELQVVNLDTAHSTKSE

• Structural information:
  • Protein Domains: (141..20-)
    (/note="MADS-box-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00251"-)
  • Interpro: IPR033897  IPR002100  IPR036879  
  • Prosite: PS00350 PS50066
  • CDD: cd00266
  • PDB: 1HBX 1K6O 1SRS
  • PDBsum: 1HBX 1K6O 1SRS
  • DIP: 49
  • STRING: ENSP00000265354
• Other Databases: GeneCards:  SRF  Malacards:  SRF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0030036	actin cytoskeleton organization	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA	molecular function
GO:0000987	cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0046983	protein dimerization activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0045597	positive regulation of cell differentiation	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0001829	trophectodermal cell differentiation	IDA	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071333	cellular response to glucose stimulus	IEA	biological process
GO:0046016	positive regulation of transcription by glucose	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0030336	negative regulation of cell migration	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0007616	long-term memory	IEA	biological process
GO:1902894	negative regulation of pri-miRNA transcription by RNA polymerase II	IEA	biological process
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0090009	primitive streak formation	IEA	biological process
GO:0061629	RNA polymerase II-specific DNA-binding transcription factor binding	IEA	molecular function
GO:0061029	eyelid development in camera-type eye	IEA	biological process
GO:0060324	face development	IEA	biological process
GO:0055003	cardiac myofibril assembly	IEA	biological process
GO:0051491	positive regulation of filopodium assembly	IEA	biological process
GO:0048821	erythrocyte development	IEA	biological process
GO:0048538	thymus development	IEA	biological process
GO:0046716	muscle cell cellular homeostasis	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0045773	positive regulation of axon extension	IEA	biological process
GO:0045059	positive thymic T cell selection	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0042789	mRNA transcription by RNA polymerase II	IEA	biological process
GO:0031175	neuron projection development	IEA	biological process
GO:0030878	thyroid gland development	IEA	biological process
GO:0030220	platelet formation	IEA	biological process
GO:0030168	platelet activation	IEA	biological process
GO:0030155	regulation of cell adhesion	IEA	biological process
GO:0030038	contractile actin filament bundle assembly	IEA	biological process
GO:0030036	actin cytoskeleton organization	IEA	biological process
GO:0021766	hippocampus development	IEA	biological process
GO:0010736	serum response element binding	IEA	molecular function
GO:0010669	epithelial structure maintenance	IEA	biological process
GO:0007160	cell-matrix adhesion	IEA	biological process
GO:0007015	actin filament organization	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0003257	positive regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation	IEA	biological process
GO:0002521	leukocyte differentiation	IEA	biological process
GO:0002011	morphogenesis of an epithelial sheet	IEA	biological process
GO:0001947	heart looping	IEA	biological process
GO:0001764	neuron migration	IEA	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0042826	histone deacetylase binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:1902895	positive regulation of pri-miRNA transcription by RNA polymerase II	IEA	biological process
GO:0090136	epithelial cell-cell adhesion	IEA	biological process
GO:0070878	primary miRNA binding	IEA	molecular function
GO:0070830	bicellular tight junction assembly	IEA	biological process
GO:0061145	lung smooth muscle development	IEA	biological process
GO:0060947	cardiac vascular smooth muscle cell differentiation	IEA	biological process
GO:0060534	trachea cartilage development	IEA	biological process
GO:0060532	bronchus cartilage development	IEA	biological process
GO:0060425	lung morphogenesis	IEA	biological process
GO:0060347	heart trabecula formation	IEA	biological process
GO:0060292	long-term synaptic depression	IEA	biological process
GO:0060218	hematopoietic stem cell differentiation	IEA	biological process
GO:0048589	developmental growth	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0045214	sarcomere organization	IEA	biological process
GO:0043589	skin morphogenesis	IEA	biological process
GO:0043149	stress fiber assembly	IEA	biological process
GO:0035912	dorsal aorta morphogenesis	IEA	biological process
GO:0035855	megakaryocyte development	IEA	biological process
GO:0033561	regulation of water loss via skin	IEA	biological process
GO:0031490	chromatin DNA binding	IEA	molecular function
GO:0030900	forebrain development	IEA	biological process
GO:0022028	tangential migration from the subventricular zone to the olfactory bulb	IEA	biological process
GO:0010735	positive regulation of transcription via serum response element binding	IEA	biological process
GO:0008306	associative learning	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0007369	gastrulation	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0002042	cell migration involved in sprouting angiogenesis	IEA	biological process
GO:0001707	mesoderm formation	IEA	biological process
GO:0001701	in utero embryonic development	IEA	biological process
GO:0001569	branching involved in blood vessel morphogenesis	IEA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA	molecular function
GO:0000790	nuclear chromatin	IEA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0070878	primary miRNA binding	ISS	molecular function
GO:1902894	negative regulation of pri-miRNA transcription by RNA polymerase II	ISS	biological process
GO:1902895	positive regulation of pri-miRNA transcription by RNA polymerase II	ISS	biological process
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0010736	serum response element binding	IDA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045987	positive regulation of smooth muscle contraction	IDA	biological process
GO:0001666	response to hypoxia	IEP	biological process
GO:0001947	heart looping	ISS	biological process
GO:0003257	positive regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation	IGI	biological process
GO:0009636	response to toxic substance	TAS	biological process
GO:0034097	response to cytokine	NAS	biological process
GO:0034097	response to cytokine	IMP	biological process
GO:0046716	muscle cell cellular homeostasis	ISS	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0009725	response to hormone	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0060261	positive regulation of transcription initiation from RNA polymerase II promoter	IDA	biological process
GO:0002042	cell migration involved in sprouting angiogenesis	IMP	biological process
GO:0005737	cytoplasm	TAS	cellular component
GO:0007507	heart development	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0048666	neuron development	TAS	biological process
GO:0051150	regulation of smooth muscle cell differentiation	TAS	biological process
GO:0060055	angiogenesis involved in wound healing	TAS	biological process
GO:0090398	cellular senescence	IMP	biological process
GO:1900222	negative regulation of amyloid-beta clearance	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003700	DNA-binding transcription factor activity	IMP	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0051091	positive regulation of DNA-binding transcription factor activity	IMP	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa05166	Human T-cell leukemia virus 1 infection
hsa05203	Viral carcinogenesis
hsa04022	cGMP-PKG signaling pathway
P06959	CCKR signaling map
P06959	CCKR signaling map

Diseases

Associated diseases	References
Cardiomyopathy	PMID:12874181
Lymphangioleiomyomatosis	PMID:12654640
congestive heart failure	PMID:11893590
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881