Male Infertility Database

Search Result

Gene id

672

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed

Gene Summary

Gene Symbol

BRCA1 Gene UCSC Ensembl

Aliases

BRCAI, BRCC1, BROVCA1, FANCS, IRIS, PNCA4, PPP1R53, PSCP, RNF53

Gene name

BRCA1, DNA repair associated

Alternate names

breast cancer type 1 susceptibility protein, BRCA1/BRCA2-containing complex, subunit 1, Fanconi anemia, complementation group S, RING finger protein 53, breast and ovarian cancer susceptibility protein 1, breast cancer 1, early onset, early onset breast c,

Gene location

17q21.31 (43125482: 43044294) Exons: 24 NC_000017.11

Gene summary(Entrez)

This gene encodes a nuclear phosphoprotein that plays a role in maintaining genomic stability, and it also acts as a tumor suppressor. The encoded protein combines with other tumor suppressors, DNA damage sensors, and signal transducers to form a large mu

OMIM

113705

Protein Summary

Protein general information

P38398

Name: Breast cancer type 1 susceptibility protein (EC 2.3.2.27) (RING finger protein 53) (RING type E3 ubiquitin transferase BRCA1)

Length: 1863 Mass: 207,721

Tissue specificity: Detected in all tissues examined, with higher expression in testis, heart, skeletal muscle, liver, and kidney.

Sequence

MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQE
STRFSQLVEELLKIICAFQLDTGLEYANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSLQET
SLSVQLSNLGTVRTLRTKQRIQPQKTSVYIELGSDSSEDTVNKATYCSVGDQELLQITPQGTRDEISLDSAKKAA
CEFSETDVTNTEHHQPSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASSLQHENSSLLLTKDRMNVE
KAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLNADPLCERKEWNKQKLPCSENPRDTEDVPWITL
NSSIQKVNEWFSRSDELLGSDDSHDGESESNAKVADVLDVLNEVDEYSGSSEKIDLLASDPHEALICKSERVHSK
SVESNIEDKIFGKTYRKKASLPNLSHVTENLIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADLAV
QKTPEMINQGTNQTEQNGQVMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTKAEPISSSISNMELELNI
HNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDSCSSSEEIKKKKYNQMPVRHSRNLQLMEGKEPA
TGAKKSNKPNEQTSKRHDSDTFPELKLTNAPGSFTKCSNTSELKEFVNPSLPREEKEEKLETVKVSNNAEDPKDL
MLSGERVLQTERSVESSSISLVPGTDYGTQESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDNRND
TEGFKYPLGHEVNHSRETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECATFSAHSGSLKKQSPKVT
FECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAKCSIKGGSRFCLSSQFRGNETGLITPNKHGLLQ
NPYRIPPLFPIKSFVKTKCKKNLLEENFEEHSMSPEREMGNENIPSTVSTISRNNIRENVFKEASSSNINEVGSS
TNEVGSSINEIGSSDENIQAELGRNRGPKLNAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTDFS
PYLISDNLEQPMGSSHASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSPSPFTHTHLAQ
GYRRGAKKLESSEENLSSEDEELPCFQHLLFGKVNNIPSQSTRHSTVATECLSKNTEENLLSLKNSLNDCSNQVI
LAKASQEHHLSEETKCSASLFSSQCSELEDLTANTNTQDPFLIGSSKQMRHQSESQGVGLSDKELVSDDEERGTG
LEENNQEEQSMDSNLGEAASGCESETSVSEDCSGLSSQSDILTTQQRDTMQHNLIKLQQEMAELEAVLEQHGSQP
SNSYPSIISDSSALEDLRNPEQSTSEKAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVERSSPSK
CPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSYLPRQDLEGTPYLESGISLFSDDP
ESDPSEDRAPESARVGNIPSSTSALKVPQLKVAESAQSPAAAHTTDTAGYNAMEESVSREKPELTASTERVNKRM
SMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKE
RKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTL
GTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY

Structural information

Protein Domains	BRCT (1642-1736) BRCT (1756-1855)
Interpro:	IPR011364 IPR031099 IPR025994 IPR001357 IPR036420 IPR018957 IPR001841 IPR013083 IPR017907
Prosite:	PS50172 PS00518 PS50089
CDD:	cd00027
PDB:	1JM7 1JNX 1N5O 1OQA 1T15 1T29 1T2U 1T2V 1Y98 2ING 3COJ 3K0H 3K0K 3K15 3K16 3PXA 3PXB 3PXC 3PXD 3PXE 4IFI 4IGK 4JLU 4OFB 4U4A 4Y18 4Y2G
PDBsum:	1JM7 1JNX 1N5O 1OQA 1T15 1T29 1T2U 1T2V 1Y98 2ING 3COJ 3K0H 3K0K 3K15 3K16 3PXA 3PXB 3PXC 3PXD 3PXE 4IFI 4IGK 4JLU 4OFB 4U4A 4Y18 4Y2G
DIP:	5971
MINT:
STRING:	ENSP00000418960

Other Databases

GeneCards: BRCA1 Malacards: BRCA1

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0000151	ubiquitin ligase complex	NAS	cellular component
GO:0000724	double-strand break repai r via homologous recombin ation	IDA	biological process
GO:0000729	DNA double-strand break p rocessing	TAS	biological process
GO:0000731	DNA synthesis involved in DNA repair	TAS	biological process
GO:0000732	strand displacement	TAS	biological process
GO:0000794	condensed nuclear chromos ome	IEA	cellular component
GO:0003677	DNA binding	TAS	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0003684	damaged DNA binding	IEA	molecular function
GO:0003713	transcription coactivator activity	NAS	molecular function
GO:0003723	RNA binding	IDA	molecular function
GO:0004842	ubiquitin-protein transfe rase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transfe rase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transfe rase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transfe rase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005694	chromosome	ISS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0006301	postreplication repair	IDA	biological process
GO:0006302	double-strand break repai r	IMP	biological process
GO:0006302	double-strand break repai r	IMP	biological process
GO:0006302	double-strand break repai r	IMP	biological process
GO:0006302	double-strand break repai r	IDA	biological process
GO:0006303	double-strand break repai r via nonhomologous end j oining	TAS	biological process
GO:0006349	regulation of gene expres sion by genetic imprintin g	IEA	biological process
GO:0006351	transcription, DNA-templa ted	IEA	biological process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	TAS	biological process
GO:0006359	regulation of transcripti on from RNA polymerase II I promoter	TAS	biological process
GO:0006633	fatty acid biosynthetic p rocess	IEA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006974	cellular response to DNA damage stimulus	TAS	biological process
GO:0006978	DNA damage response, sign al transduction by p53 cl ass mediator resulting in transcription of p21 cla ss mediator	TAS	biological process
GO:0007059	chromosome segregation	IMP	biological process
GO:0007098	centrosome cycle	IEA	biological process
GO:0007420	brain development	IEA	biological process
GO:0007584	response to nutrient	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0008274	gamma-tubulin ring comple x	NAS	cellular component
GO:0008630	intrinsic apoptotic signa ling pathway in response to DNA damage	IDA	biological process
GO:0009048	dosage compensation by in activation of X chromosom e	IBA	biological process
GO:0010212	response to ionizing radi ation	IMP	biological process
GO:0010212	response to ionizing radi ation	IMP	biological process
GO:0010212	response to ionizing radi ation	IMP	biological process
GO:0010575	positive regulation of va scular endothelial growth factor production	IMP	biological process
GO:0010628	positive regulation of ge ne expression	IMP	biological process
GO:0015631	tubulin binding	NAS	molecular function
GO:0016567	protein ubiquitination	IDA	biological process
GO:0016874	ligase activity	IEA	molecular function
GO:0016925	protein sumoylation	TAS	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0030521	androgen receptor signali ng pathway	NAS	biological process
GO:0030529	intracellular ribonucleop rotein complex	IDA	cellular component
GO:0031052	chromosome breakage	IEA	biological process
GO:0031398	positive regulation of pr otein ubiquitination	IDA	biological process
GO:0031436	BRCA1-BARD1 complex	IDA	cellular component
GO:0031436	BRCA1-BARD1 complex	IDA	cellular component
GO:0031436	BRCA1-BARD1 complex	IDA	cellular component
GO:0031436	BRCA1-BARD1 complex	IDA	cellular component
GO:0031572	G2 DNA damage checkpoint	IMP	biological process
GO:0031572	G2 DNA damage checkpoint	IMP	biological process
GO:0031572	G2 DNA damage checkpoint	IMP	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0032355	response to estradiol	IEA	biological process
GO:0033147	negative regulation of in tracellular estrogen rece ptor signaling pathway	IMP	biological process
GO:0033160	positive regulation of pr otein import into nucleus , translocation	IEA	biological process
GO:0035066	positive regulation of hi stone acetylation	IDA	biological process
GO:0035067	negative regulation of hi stone acetylation	IBA	biological process
GO:0042127	regulation of cell prolif eration	TAS	biological process
GO:0042981	regulation of apoptotic p rocess	TAS	biological process
GO:0043009	chordate embryonic develo pment	IBA	biological process
GO:0043234	protein complex	IDA	cellular component
GO:0043627	response to estrogen	IDA	biological process
GO:0044030	regulation of DNA methyla tion	IEA	biological process
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0045717	negative regulation of fa tty acid biosynthetic pro cess	IMP	biological process
GO:0045739	positive regulation of DN A repair	IMP	biological process
GO:0045739	positive regulation of DN A repair	IMP	biological process
GO:0045739	positive regulation of DN A repair	IMP	biological process
GO:0045766	positive regulation of an giogenesis	IMP	biological process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological process
GO:0045893	positive regulation of tr anscription, DNA-template d	TAS	biological process
GO:0045893	positive regulation of tr anscription, DNA-template d	NAS	biological process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological process
GO:0046600	negative regulation of ce ntriole replication	NAS	biological process
GO:0050681	androgen receptor binding	NAS	molecular function
GO:0051571	positive regulation of hi stone H3-K4 methylation	IDA	biological process
GO:0051572	negative regulation of hi stone H3-K4 methylation	IEA	biological process
GO:0051573	negative regulation of hi stone H3-K9 methylation	IDA	biological process
GO:0051574	positive regulation of hi stone H3-K9 methylation	IEA	biological process
GO:0051865	protein autoubiquitinatio n	IDA	biological process
GO:0051865	protein autoubiquitinatio n	IDA	biological process
GO:0070512	positive regulation of hi stone H4-K20 methylation	IDA	biological process
GO:0070531	BRCA1-A complex	IDA	cellular component
GO:0070531	BRCA1-A complex	IDA	cellular component
GO:0070531	BRCA1-A complex	IDA	cellular component
GO:0070531	BRCA1-A complex	IDA	cellular component
GO:0070531	BRCA1-A complex	IDA	cellular component
GO:0071158	positive regulation of ce ll cycle arrest	IDA	biological process
GO:0071356	cellular response to tumo r necrosis factor	IMP	biological process
GO:0071681	cellular response to indo le-3-methanol	IDA	biological process
GO:0085020	protein K6-linked ubiquit ination	IDA	biological process
GO:0085020	protein K6-linked ubiquit ination	IDA	biological process
GO:1901796	regulation of signal tran sduction by p53 class med iator	TAS	biological process
GO:1902042	negative regulation of ex trinsic apoptotic signali ng pathway via death doma in receptors	IMP	biological process
GO:2000378	negative regulation of re active oxygen species met abolic process	IMP	biological process
GO:2000617	positive regulation of hi stone H3-K9 acetylation	IDA	biological process
GO:2000620	positive regulation of hi stone H4-K16 acetylation	IDA	biological process
GO:0000151	ubiquitin ligase complex	NAS	cellular component
GO:0000724	double-strand break repai r via homologous recombin ation	IDA	biological process
GO:0000729	DNA double-strand break p rocessing	TAS	biological process
GO:0000731	DNA synthesis involved in DNA repair	TAS	biological process
GO:0000732	strand displacement	TAS	biological process
GO:0000793	condensed chromosome	IEA	cellular component
GO:0000794	condensed nuclear chromos ome	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	TAS	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0003684	damaged DNA binding	IEA	molecular function
GO:0003713	transcription coactivator activity	NAS	molecular function
GO:0003723	RNA binding	IDA	molecular function
GO:0004842	ubiquitin-protein transfe rase activity	IEA	molecular function
GO:0004842	ubiquitin-protein transfe rase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transfe rase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transfe rase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transfe rase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005694	chromosome	ISS	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006260	DNA replication	IEA	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0006301	postreplication repair	IDA	biological process
GO:0006302	double-strand break repai r	IEA	biological process
GO:0006302	double-strand break repai r	IMP	biological process
GO:0006302	double-strand break repai r	IMP	biological process
GO:0006302	double-strand break repai r	IMP	biological process
GO:0006302	double-strand break repai r	IDA	biological process
GO:0006303	double-strand break repai r via nonhomologous end j oining	TAS	biological process
GO:0006310	DNA recombination	IEA	biological process
GO:0006349	regulation of gene expres sion by genetic imprintin g	IEA	biological process
GO:0006351	transcription, DNA-templa ted	IEA	biological process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	TAS	biological process
GO:0006359	regulation of transcripti on from RNA polymerase II I promoter	TAS	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0006631	fatty acid metabolic proc ess	IEA	biological process
GO:0006633	fatty acid biosynthetic p rocess	IEA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	TAS	biological process
GO:0006978	DNA damage response, sign al transduction by p53 cl ass mediator resulting in transcription of p21 cla ss mediator	TAS	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0007059	chromosome segregation	IMP	biological process
GO:0007098	centrosome cycle	IEA	biological process
GO:0007420	brain development	IEA	biological process
GO:0007584	response to nutrient	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0008270	zinc ion binding	TAS	molecular function
GO:0008274	gamma-tubulin ring comple x	NAS	cellular component
GO:0008630	intrinsic apoptotic signa ling pathway in response to DNA damage	IDA	biological process
GO:0009048	dosage compensation by in activation of X chromosom e	IEA	biological process
GO:0009048	dosage compensation by in activation of X chromosom e	IBA	biological process
GO:0010033	response to organic subst ance	IEA	biological process
GO:0010212	response to ionizing radi ation	IMP	biological process
GO:0010212	response to ionizing radi ation	IMP	biological process
GO:0010212	response to ionizing radi ation	IMP	biological process
GO:0010575	positive regulation of va scular endothelial growth factor production	IMP	biological process
GO:0010628	positive regulation of ge ne expression	IMP	biological process
GO:0015631	tubulin binding	NAS	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0016874	ligase activity	IEA	molecular function
GO:0016925	protein sumoylation	TAS	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0030521	androgen receptor signali ng pathway	NAS	biological process
GO:0030529	intracellular ribonucleop rotein complex	IDA	cellular component
GO:0031052	chromosome breakage	IEA	biological process
GO:0031398	positive regulation of pr otein ubiquitination	IDA	biological process
GO:0031436	BRCA1-BARD1 complex	IDA	cellular component
GO:0031436	BRCA1-BARD1 complex	IDA	cellular component
GO:0031436	BRCA1-BARD1 complex	IDA	cellular component
GO:0031436	BRCA1-BARD1 complex	IDA	cellular component
GO:0031572	G2 DNA damage checkpoint	IMP	biological process
GO:0031572	G2 DNA damage checkpoint	IMP	biological process
GO:0031572	G2 DNA damage checkpoint	IMP	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0032355	response to estradiol	IEA	biological process
GO:0033147	negative regulation of in tracellular estrogen rece ptor signaling pathway	IMP	biological process
GO:0033160	positive regulation of pr otein import into nucleus , translocation	IEA	biological process
GO:0033993	response to lipid	IEA	biological process
GO:0035066	positive regulation of hi stone acetylation	IEA	biological process
GO:0035066	positive regulation of hi stone acetylation	IDA	biological process
GO:0035067	negative regulation of hi stone acetylation	IEA	biological process
GO:0035067	negative regulation of hi stone acetylation	IBA	biological process
GO:0042127	regulation of cell prolif eration	TAS	biological process
GO:0042981	regulation of apoptotic p rocess	TAS	biological process
GO:0043009	chordate embryonic develo pment	IEA	biological process
GO:0043009	chordate embryonic develo pment	IBA	biological process
GO:0043234	protein complex	IDA	cellular component
GO:0043627	response to estrogen	IDA	biological process
GO:0044030	regulation of DNA methyla tion	IEA	biological process
GO:0044212	transcription regulatory region DNA binding	IEA	molecular function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0045717	negative regulation of fa tty acid biosynthetic pro cess	IMP	biological process
GO:0045739	positive regulation of DN A repair	IMP	biological process
GO:0045739	positive regulation of DN A repair	IMP	biological process
GO:0045739	positive regulation of DN A repair	IMP	biological process
GO:0045766	positive regulation of an giogenesis	IMP	biological process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological process
GO:0045893	positive regulation of tr anscription, DNA-template d	TAS	biological process
GO:0045893	positive regulation of tr anscription, DNA-template d	NAS	biological process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological process
GO:0046600	negative regulation of ce ntriole replication	NAS	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0050681	androgen receptor binding	NAS	molecular function
GO:0051571	positive regulation of hi stone H3-K4 methylation	IEA	biological process
GO:0051571	positive regulation of hi stone H3-K4 methylation	IDA	biological process
GO:0051572	negative regulation of hi stone H3-K4 methylation	IEA	biological process
GO:0051573	negative regulation of hi stone H3-K9 methylation	IEA	biological process
GO:0051573	negative regulation of hi stone H3-K9 methylation	IDA	biological process
GO:0051574	positive regulation of hi stone H3-K9 methylation	IEA	biological process
GO:0051865	protein autoubiquitinatio n	IDA	biological process
GO:0051865	protein autoubiquitinatio n	IDA	biological process
GO:0070512	positive regulation of hi stone H4-K20 methylation	IEA	biological process
GO:0070512	positive regulation of hi stone H4-K20 methylation	IDA	biological process
GO:0070531	BRCA1-A complex	IDA	cellular component
GO:0070531	BRCA1-A complex	IDA	cellular component
GO:0070531	BRCA1-A complex	IDA	cellular component
GO:0070531	BRCA1-A complex	IDA	cellular component
GO:0070531	BRCA1-A complex	IDA	cellular component
GO:0071158	positive regulation of ce ll cycle arrest	IDA	biological process
GO:0071356	cellular response to tumo r necrosis factor	IMP	biological process
GO:0071681	cellular response to indo le-3-methanol	IDA	biological process
GO:0085020	protein K6-linked ubiquit ination	IDA	biological process
GO:0085020	protein K6-linked ubiquit ination	IDA	biological process
GO:1901796	regulation of signal tran sduction by p53 class med iator	TAS	biological process
GO:1902042	negative regulation of ex trinsic apoptotic signali ng pathway via death doma in receptors	IMP	biological process
GO:2000378	negative regulation of re active oxygen species met abolic process	IMP	biological process
GO:2000617	positive regulation of hi stone H3-K9 acetylation	IEA	biological process
GO:2000617	positive regulation of hi stone H3-K9 acetylation	IDA	biological process
GO:2000620	positive regulation of hi stone H4-K16 acetylation	IEA	biological process
GO:2000620	positive regulation of hi stone H4-K16 acetylation	IDA	biological process
GO:0000151	ubiquitin ligase complex	NAS	cellular component
GO:0000724	double-strand break repai r via homologous recombin ation	IDA	biological process
GO:0000729	DNA double-strand break p rocessing	TAS	biological process
GO:0000731	DNA synthesis involved in DNA repair	TAS	biological process
GO:0000732	strand displacement	TAS	biological process
GO:0003677	DNA binding	TAS	molecular function
GO:0003713	transcription coactivator activity	NAS	molecular function
GO:0003723	RNA binding	IDA	molecular function
GO:0004842	ubiquitin-protein transfe rase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transfe rase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transfe rase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transfe rase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005694	chromosome	ISS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0006301	postreplication repair	IDA	biological process
GO:0006302	double-strand break repai r	IMP	biological process
GO:0006302	double-strand break repai r	IMP	biological process
GO:0006302	double-strand break repai r	IMP	biological process
GO:0006302	double-strand break repai r	IDA	biological process
GO:0006303	double-strand break repai r via nonhomologous end j oining	TAS	biological process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	TAS	biological process
GO:0006359	regulation of transcripti on from RNA polymerase II I promoter	TAS	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006974	cellular response to DNA damage stimulus	TAS	biological process
GO:0006978	DNA damage response, sign al transduction by p53 cl ass mediator resulting in transcription of p21 cla ss mediator	TAS	biological process
GO:0007059	chromosome segregation	IMP	biological process
GO:0008270	zinc ion binding	TAS	molecular function
GO:0008274	gamma-tubulin ring comple x	NAS	cellular component
GO:0008630	intrinsic apoptotic signa ling pathway in response to DNA damage	IDA	biological process
GO:0009048	dosage compensation by in activation of X chromosom e	IBA	biological process
GO:0010212	response to ionizing radi ation	IMP	biological process
GO:0010212	response to ionizing radi ation	IMP	biological process
GO:0010212	response to ionizing radi ation	IMP	biological process
GO:0010575	positive regulation of va scular endothelial growth factor production	IMP	biological process
GO:0010628	positive regulation of ge ne expression	IMP	biological process
GO:0015631	tubulin binding	NAS	molecular function
GO:0016567	protein ubiquitination	IDA	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0030521	androgen receptor signali ng pathway	NAS	biological process
GO:0030529	intracellular ribonucleop rotein complex	IDA	cellular component
GO:0031398	positive regulation of pr otein ubiquitination	IDA	biological process
GO:0031436	BRCA1-BARD1 complex	IDA	cellular component
GO:0031436	BRCA1-BARD1 complex	IDA	cellular component
GO:0031436	BRCA1-BARD1 complex	IDA	cellular component
GO:0031436	BRCA1-BARD1 complex	IDA	cellular component
GO:0031572	G2 DNA damage checkpoint	IMP	biological process
GO:0031572	G2 DNA damage checkpoint	IMP	biological process
GO:0031572	G2 DNA damage checkpoint	IMP	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0033147	negative regulation of in tracellular estrogen rece ptor signaling pathway	IMP	biological process
GO:0035066	positive regulation of hi stone acetylation	IDA	biological process
GO:0035067	negative regulation of hi stone acetylation	IBA	biological process
GO:0042127	regulation of cell prolif eration	TAS	biological process
GO:0042981	regulation of apoptotic p rocess	TAS	biological process
GO:0043009	chordate embryonic develo pment	IBA	biological process
GO:0043234	protein complex	IDA	cellular component
GO:0043627	response to estrogen	IDA	biological process
GO:0044212	transcription regulatory region DNA binding	IDA	molecular function
GO:0045717	negative regulation of fa tty acid biosynthetic pro cess	IMP	biological process
GO:0045739	positive regulation of DN A repair	IMP	biological process
GO:0045739	positive regulation of DN A repair	IMP	biological process
GO:0045739	positive regulation of DN A repair	IMP	biological process
GO:0045766	positive regulation of an giogenesis	IMP	biological process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological process
GO:0045893	positive regulation of tr anscription, DNA-template d	TAS	biological process
GO:0045893	positive regulation of tr anscription, DNA-template d	NAS	biological process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological process
GO:0046600	negative regulation of ce ntriole replication	NAS	biological process
GO:0050681	androgen receptor binding	NAS	molecular function
GO:0051571	positive regulation of hi stone H3-K4 methylation	IDA	biological process
GO:0051573	negative regulation of hi stone H3-K9 methylation	IDA	biological process
GO:0051865	protein autoubiquitinatio n	IDA	biological process
GO:0051865	protein autoubiquitinatio n	IDA	biological process
GO:0070512	positive regulation of hi stone H4-K20 methylation	IDA	biological process
GO:0070531	BRCA1-A complex	IDA	cellular component
GO:0070531	BRCA1-A complex	IDA	cellular component
GO:0070531	BRCA1-A complex	IDA	cellular component
GO:0070531	BRCA1-A complex	IDA	cellular component
GO:0070531	BRCA1-A complex	IDA	cellular component
GO:0071158	positive regulation of ce ll cycle arrest	IDA	biological process
GO:0071356	cellular response to tumo r necrosis factor	IMP	biological process
GO:0071681	cellular response to indo le-3-methanol	IDA	biological process
GO:0085020	protein K6-linked ubiquit ination	IDA	biological process
GO:0085020	protein K6-linked ubiquit ination	IDA	biological process
GO:1901796	regulation of signal tran sduction by p53 class med iator	TAS	biological process
GO:1902042	negative regulation of ex trinsic apoptotic signali ng pathway via death doma in receptors	IMP	biological process
GO:2000378	negative regulation of re active oxygen species met abolic process	IMP	biological process
GO:2000617	positive regulation of hi stone H3-K9 acetylation	IDA	biological process
GO:2000620	positive regulation of hi stone H4-K16 acetylation	IDA	biological process

KEGG pathways

Expand All | Collapse All

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa05206	MicroRNAs in cancer
hsa05224	Breast cancer
hsa01524	Platinum drug resistance

Diseases

Expand All | Collapse All

Associated diseases	References
Cancer (Adenocarcinoma)	GAD: 19690177
Cancer (Adenoma)	GAD: 19031948
Cancer (cervical)	GAD: 19012493
Cancer (colorectal)	GAD: 14709740
Cancer (cystadenocarcinoma)	GAD: 19543244
Cancer (endometrial)	GAD: 11263938
Cancer (epithelial ovarian)	GAD: 19064572
Cancer (lymphoma)	GAD: 16639601
Cancer (ovarian)	GAD: 12883740
Cancer (pancreas adenocarcinomas)	GAD: 19548527
Cancer (pancreatic)	GAD: 20195775
Cancer (prostate)	GAD: 16638864
Cancer (stomach)	GAD: 20331623
Cancer (ovarian)	KEGG: H00027
Cancer (basal cell)	GAD: 20809262
Cancer (bladder)	GAD: 19692168
Cancer (brain)	GAD: 18559551
Cancer (esophageal)	GAD: 20453000
Cancer (fallopian tube)	GAD: 20452659
Cancer (leukemia)	GAD: 15159312
Cancer (lung)	GAD: 18676680
Cancer (breast)	GAD: 12036913
Cardiovascular disease	GAD: 19747471
Hodgkin disease	GAD: 19573080
Multiple sclerosis	GAD: 20522537
Chronic renal failure	GAD: 21085059
Ovarian diseases	GAD: 19258944
Premature menopause	INFBASE: 16773440
Endometriosis	INFBASE: 25380576
Female infertility	INFBASE: 12568865
Ovarian reserve	INFBASE: 25256924
Azoospermia	MIK: 19200961
Oligoasthenoteratospermia	MIK: 18155199
Oligoasthenoteratospermia	MIK: 18155199
Male factor infertility	MIK: 18270180
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Meningomyelocele Spinal Dysraphism	GAD: 17640328
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Azoospermia	MIK: 19200961
Cryptorchidism	MIK: 28606200
Female Infertility	MIK: 18155199
Oligoasthenoteratospermia	MIK: 18155199
Male infertility	MIK: 18270180
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

Expand All | Collapse All

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
19200961	Azoospermi a			6 (1 azoospermi c patient, 5 me n with normal s permatogenesis)	Male infertility		Show abstract
18270180	Male infer tility			2	Male infertility		Show abstract
18155199	Female Inf ertility, Oligoasth enoteratos permia	BRCA1(c.5382insc exon 20 codon 1755)	Ashkena zi Jewi sh woma n	1 women with in fertility	Male infertility, Female infertility		Show abstract
17327269	Teratozoos permia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
17327269	Teratozoos permia			19 (6 controls , 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
21674046	Aberrant C pGs in Low Motility Sperm			18	Male infertility	GSE26881	Show abstract
28606200	Cryptorchi dism			Monozgotic twin s (1 control, I cwith cryptorc hidism)	Male infertility	MeDIP-Seq	Show abstract
31037746	Spermatoge nic defect s			28 men with az oospermia	Male infertility	Microarray	Show abstract
25753583	Unexplaine d infertil ity			46 (17 fertile men, 29 male pa tients)	Male infertility	Microarray	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways Expand All | Collapse All

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Diseases

Expand All | Collapse All