• Gene id: 6717

Gene Summary

• Gene Symbol: SRI   Gene   UCSC   Ensembl
• Aliases: CP-22, CP22, SCN, V19
• Gene name: sorcin
• Alternate names: sorcin, 22 kDa protein, H_RG167B05.1, calcium binding protein amplified in mutlidrug-resistant cells,
• Gene location: 7q21.12 (50507780: 50502948)     Exons: 14     NC_000022.11
• Gene summary(Entrez): This gene encodes a calcium-binding protein with multiple E-F hand domains that relocates from the cytoplasm to the sarcoplasmic reticulum in response to elevated calcium levels. In addition to regulating intracellular calcium homeostasis it also modulate
• OMIM: 182520

Protein Summary

• Protein general information: P30626  
  • Name: Sorcin (22 kDa protein) (CP 22) (CP22) (V19)
  • Length: 198  
  • Mass: 21676
  • Tissue specificity: Detected in cardiac myocytes.
• Sequence:

  MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETC
  RLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYST
  NGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV

• Structural information:
  • Protein Domains: (29..6-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (70..10-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (100..13-)
    (/note="EF-hand-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00-)
  • Interpro: IPR011992  IPR018247  IPR002048  
  • Prosite: PS00018 PS50222
  • PDB: 1JUO 2JC2 4U8D 4UPG 4USL 5MRA
  • PDBsum: 1JUO 2JC2 4U8D 4UPG 4USL 5MRA
  • DIP: 40970
  • STRING: ENSP00000265729
• Other Databases: GeneCards:  SRI  Malacards:  SRI

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005509	calcium ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016529	sarcoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005246	calcium channel regulator activity	TAS	molecular function
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0006880	intracellular sequestering of iron ion	TAS	biological process
GO:0006942	regulation of striated muscle contraction	TAS	biological process
GO:0007507	heart development	TAS	biological process
GO:0001508	action potential	TAS	biological process
GO:0007517	muscle organ development	TAS	biological process
GO:0008016	regulation of heart contraction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005790	smooth endoplasmic reticulum	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0030315	T-tubule	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0006816	calcium ion transport	IEA	biological process
GO:0035774	positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA	biological process
GO:0055118	negative regulation of cardiac muscle contraction	IEA	biological process
GO:2000678	negative regulation of transcription regulatory region DNA binding	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007507	heart development	IEA	biological process
GO:0030018	Z disc	IEA	cellular component
GO:0043679	axon terminus	IEA	cellular component
GO:0044326	dendritic spine neck	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0030018	Z disc	IEA	cellular component
GO:0031982	vesicle	IEA	cellular component
GO:0042994	cytoplasmic sequestering of transcription factor	IEA	biological process
GO:0051281	positive regulation of release of sequestered calcium ion into cytosol	IEA	biological process
GO:0070491	repressing transcription factor binding	IEA	molecular function
GO:0005509	calcium ion binding	IDA	molecular function
GO:0044325	ion channel binding	TAS	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0042584	chromaffin granule membrane	IDA	colocalizes with
GO:0010880	regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum	TAS	biological process
GO:0016529	sarcoplasmic reticulum	TAS	cellular component
GO:0030315	T-tubule	TAS	cellular component
GO:0051924	regulation of calcium ion transport	IMP	biological process
GO:0051924	regulation of calcium ion transport	IMP	biological process
GO:1901077	regulation of relaxation of muscle	IMP	biological process
GO:1901844	regulation of cell communication by electrical coupling involved in cardiac conduction	IMP	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0030018	Z disc	IDA	cellular component
GO:0060315	negative regulation of ryanodine-sensitive calcium-release channel activity	IDA	biological process
GO:0010459	negative regulation of heart rate	IMP	biological process
GO:0010649	regulation of cell communication by electrical coupling	TAS	biological process
GO:0086004	regulation of cardiac muscle cell contraction	IMP	biological process
GO:0086004	regulation of cardiac muscle cell contraction	IMP	biological process
GO:1901841	regulation of high voltage-gated calcium channel activity	IMP	biological process
GO:0033017	sarcoplasmic reticulum membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0005737	cytoplasm	TAS	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray