Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 6714
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol SRC   Gene   UCSC   Ensembl
Aliases ASV, SRC1, THC6, c-SRC, p60-Src
Gene name SRC proto-oncogene, non-receptor tyrosine kinase
Alternate names proto-oncogene tyrosine-protein kinase Src, proto-oncogene c-Src, protooncogene SRC, Rous sarcoma, tyrosine kinase pp60c-src, tyrosine-protein kinase SRC-1, v-src avian sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog,
Gene location 20q11.23 (37344684: 37405431)     Exons: 17     NC_000020.11
Gene summary(Entrez) This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibi
OMIM 190090

Protein Summary
Protein general information P12931  

Name: Proto oncogene tyrosine protein kinase Src (EC 2.7.10.2) (Proto oncogene c Src) (pp60c src) (p60 Src)

Length: 536  Mass: 59,835

Sequence MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTS
PQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEE
WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNS
LQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIAS
GMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWS
FGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTS
TEPQYQPGENL
Structural information
Protein Domains
 SH3. (84-145)
SH2. (151-248)
Protein (270-523)
Interpro:  IPR011009  IPR000719  IPR017441  IPR001245  IPR000980  
IPR036860  IPR036028  IPR001452  IPR008266  IPR020635  
Prosite:   PS00107 PS50011 PS00109 PS50001 PS50002

PDB:  		 1A07 1A08 1A09 1A1A 1A1B 1A1C 1A1E 1FMK 1HCS 1HCT 1KSW 1O41 1O42 1O43 1O44 1O45 1O46 1O47 1O48 1O49 1O4A 1O4B 1O4C 1O4D 1O4E 1O4F 1O4G 1O4H 1O4I 1O4J 1O4K 1O4L 1O4M 1O4N 1O4O 1O4P 1O4Q 1O4R 1SHD 1Y57 1YI6 1YOJ 1YOL 1YOM 2BDF 2BDJ 2H8H 2SRC 3VRO 3ZMP 3ZMQ
PDBsum:   1A07 1A08 1A09 1A1A 1A1B 1A1C 1A1E 1FMK 1HCS 1HCT 1KSW 1O41 1O42 1O43 1O44 1O45 1O46 1O47 1O48 1O49 1O4A 1O4B 1O4C 1O4D 1O4E 1O4F 1O4G 1O4H 1O4I 1O4J 1O4K 1O4L 1O4M 1O4N 1O4O 1O4P 1O4Q 1O4R 1SHD 1Y57 1YI6 1YOJ 1YOL 1YOM 2BDF 2BDJ 2H8H 2SRC 3VRO 3ZMP 3ZMQ

DIP:  
1059
MINT:  
STRING:   ENSP00000350941
Other Databases GeneCards:  SRC  Malacards:  SRC

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0002223 stimulatory C-type lectin
receptor signaling pathw
ay
 TAS biological process
GO:0004672 protein kinase activity
 IDA molecular function
GO:0004672 protein kinase activity
 TAS molecular function
GO:0004672 protein kinase activity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 EXP molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 EXP molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 EXP molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 EXP molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 EXP molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 IDA molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 EXP molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 EXP molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 EXP molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 IDA molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 EXP molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004715 non-membrane spanning pro
tein tyrosine kinase acti
vity
 TAS molecular function
GO:0005070 SH3/SH2 adaptor activity
 TAS molecular function
GO:0005080 protein kinase C binding
 IEA molecular function
GO:0005102 receptor binding
 IPI molecular function
GO:0005158 insulin receptor binding
 IEA molecular function
GO:0005178 integrin binding
 TAS molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005524 ATP binding
 IEA molecular function
GO:0005634 nucleus
 IEA cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:0005739 mitochondrion
 IDA cellular component
GO:0005743 mitochondrial inner membr
ane
 IDA cellular component
GO:0005764 lysosome
 IDA cellular component
GO:0005770 late endosome
 IDA cellular component
GO:0005829 cytosol
 IDA cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005884 actin filament
 IEA cellular component
GO:0005886 plasma membrane
 IDA cellular component
GO:0005886 plasma membrane
 IDA cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005901 caveola
 IDA cellular component
GO:0007049 cell cycle
 IEA biological process
GO:0007165 signal transduction
 TAS biological process
GO:0007165 signal transduction
 TAS biological process
GO:0007172 signal complex assembly
 TAS biological process
GO:0007173 epidermal growth factor r
eceptor signaling pathway
 IBA biological process
GO:0007173 epidermal growth factor r
eceptor signaling pathway
 TAS biological process
GO:0007179 transforming growth facto
r beta receptor signaling
pathway
 IMP biological process
GO:0007229 integrin-mediated signali
ng pathway
 IMP biological process
GO:0007417 central nervous system de
velopment
 IBA biological process
GO:0008022 protein C-terminus bindin
g
 IEA molecular function
GO:0008283 cell proliferation
 IEA biological process
GO:0009612 response to mechanical st
imulus
 IEA biological process
GO:0009615 response to virus
 IEA biological process
GO:0010447 response to acidic pH
 IEA biological process
GO:0010632 regulation of epithelial
cell migration
 IMP biological process
GO:0010634 positive regulation of ep
ithelial cell migration
 IMP biological process
GO:0010641 positive regulation of pl
atelet-derived growth fac
tor receptor signaling pa
thway
 IEA biological process
GO:0010907 positive regulation of gl
ucose metabolic process
 IEA biological process
GO:0014069 postsynaptic density
 IEA cellular component
GO:0014911 positive regulation of sm
ooth muscle cell migratio
n
 IEA biological process
GO:0016032 viral process
 IEA biological process
GO:0016301 kinase activity
 TAS molecular function
GO:0016337 single organismal cell-ce
ll adhesion
 IEA biological process
GO:0018105 peptidyl-serine phosphory
lation
 IEA biological process
GO:0018108 peptidyl-tyrosine phospho
rylation
 IDA biological process
GO:0019899 enzyme binding
 IPI molecular function
GO:0019900 kinase binding
 IPI molecular function
GO:0020037 heme binding
 IDA molecular function
GO:0022407 regulation of cell-cell a
dhesion
 IMP biological process
GO:0030168 platelet activation
 TAS biological process
GO:0030331 estrogen receptor binding
 IEA molecular function
GO:0030520 intracellular estrogen re
ceptor signaling pathway
 IBA biological process
GO:0030900 forebrain development
 IEA biological process
GO:0031234 extrinsic component of cy
toplasmic side of plasma
membrane
 IBA cellular component
GO:0031295 T cell costimulation
 TAS biological process
GO:0031295 T cell costimulation
 TAS biological process
GO:0031648 protein destabilization
 IEA biological process
GO:0031667 response to nutrient leve
ls
 IEA biological process
GO:0031954 positive regulation of pr
otein autophosphorylation
 IEA biological process
GO:0032148 activation of protein kin
ase B activity
 IEA biological process
GO:0032211 negative regulation of te
lomere maintenance via te
lomerase
 IMP biological process
GO:0032463 negative regulation of pr
otein homooligomerization
 IMP biological process
GO:0032587 ruffle membrane
 IEA cellular component
GO:0032869 cellular response to insu
lin stimulus
 IEA biological process
GO:0033146 regulation of intracellul
ar estrogen receptor sign
aling pathway
 IEA biological process
GO:0033625 positive regulation of in
tegrin activation
 TAS biological process
GO:0034332 adherens junction organiz
ation
 IEA biological process
GO:0034446 substrate adhesion-depend
ent cell spreading
 IEA biological process
GO:0034614 cellular response to reac
tive oxygen species
 IEA biological process
GO:0035556 intracellular signal tran
sduction
 IDA biological process
GO:0036035 osteoclast development
 IBA biological process
GO:0036120 cellular response to plat
elet-derived growth facto
r stimulus
 IEA biological process
GO:0038083 peptidyl-tyrosine autopho
sphorylation
 IBA biological process
GO:0038096 Fc-gamma receptor signali
ng pathway involved in ph
agocytosis
 TAS biological process
GO:0038128 ERBB2 signaling pathway
 TAS biological process
GO:0042127 regulation of cell prolif
eration
 IBA biological process
GO:0042169 SH2 domain binding
 IPI molecular function
GO:0042493 response to drug
 IEA biological process
GO:0042542 response to hydrogen pero
xide
 IEA biological process
GO:0043005 neuron projection
 IEA cellular component
GO:0043065 positive regulation of ap
optotic process
 IEA biological process
GO:0043066 negative regulation of ap
optotic process
 IMP biological process
GO:0043114 regulation of vascular pe
rmeability
 TAS biological process
GO:0043149 stress fiber assembly
 IMP biological process
GO:0043154 negative regulation of cy
steine-type endopeptidase
activity involved in apo
ptotic process
 IMP biological process
GO:0043393 regulation of protein bin
ding
 IEA biological process
GO:0043406 positive regulation of MA
P kinase activity
 IEA biological process
GO:0043552 positive regulation of ph
osphatidylinositol 3-kina
se activity
 IEA biological process
GO:0044325 ion channel binding
 IPI molecular function
GO:0044325 ion channel binding
 IPI molecular function
GO:0045056 transcytosis
 IEA biological process
GO:0045087 innate immune response
 IBA biological process
GO:0045124 regulation of bone resorp
tion
 TAS biological process
GO:0045453 bone resorption
 ISS biological process
GO:0045737 positive regulation of cy
clin-dependent protein se
rine/threonine kinase act
ivity
 IEA biological process
GO:0045892 negative regulation of tr
anscription, DNA-template
d
 IEA biological process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 IEA biological process
GO:0046628 positive regulation of in
sulin receptor signaling
pathway
 IEA biological process
GO:0046777 protein autophosphorylati
on
 IDA biological process
GO:0046875 ephrin receptor binding
 IPI molecular function
GO:0048008 platelet-derived growth f
actor receptor signaling
pathway
 IBA biological process
GO:0048010 vascular endothelial grow
th factor receptor signal
ing pathway
 TAS biological process
GO:0048011 neurotrophin TRK receptor
signaling pathway
 IEA biological process
GO:0048013 ephrin receptor signaling
pathway
 TAS biological process
GO:0048471 perinuclear region of cyt
oplasm
 IEA cellular component
GO:0048477 oogenesis
 IEA biological process
GO:0050715 positive regulation of cy
tokine secretion
 IEA biological process
GO:0050731 positive regulation of pe
ptidyl-tyrosine phosphory
lation
 IC biological process
GO:0050847 progesterone receptor sig
naling pathway
 ISS biological process
GO:0050847 progesterone receptor sig
naling pathway
 IBA biological process
GO:0050900 leukocyte migration
 TAS biological process
GO:0051219 phosphoprotein binding
 IPI molecular function
GO:0051385 response to mineralocorti
coid
 IEA biological process
GO:0051427 hormone receptor binding
 IBA molecular function
GO:0051602 response to electrical st
imulus
 IEA biological process
GO:0051726 regulation of cell cycle
 IBA biological process
GO:0051895 negative regulation of fo
cal adhesion assembly
 ISS biological process
GO:0051897 positive regulation of pr
otein kinase B signaling
 IMP biological process
GO:0051902 negative regulation of mi
tochondrial depolarizatio
n
 IMP biological process
GO:0051974 negative regulation of te
lomerase activity
 IMP biological process
GO:0060065 uterus development
 IEA biological process
GO:0060444 branching involved in mam
mary gland duct morphogen
esis
 IEA biological process
GO:0060491 regulation of cell projec
tion assembly
 IEA biological process
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
 IEA biological process
GO:0070555 response to interleukin-1
 IMP biological process
GO:0070851 growth factor receptor bi
nding
 IPI molecular function
GO:0071222 cellular response to lipo
polysaccharide
 IEA biological process
GO:0071375 cellular response to pept
ide hormone stimulus
 ISS biological process
GO:0071393 cellular response to prog
esterone stimulus
 ISS biological process
GO:0071398 cellular response to fatt
y acid
 IEA biological process
GO:0071456 cellular response to hypo
xia
 IEA biological process
GO:0071498 cellular response to flui
d shear stress
 IEA biological process
GO:0071801 regulation of podosome as
sembly
 IBA biological process
GO:0071803 positive regulation of po
dosome assembly
 IEA biological process
GO:0071902 positive regulation of pr
otein serine/threonine ki
nase activity
 IDA biological process
GO:0086098 angiotensin-activated sig
naling pathway involved i
n heart process
 ISS biological process
GO:0090263 positive regulation of ca
nonical Wnt signaling pat
hway
 IEA biological process
GO:0097110 scaffold protein binding
 IPI molecular function
GO:2000394 positive regulation of la
mellipodium morphogenesis
 IMP biological process
GO:2000573 positive regulation of DN
A biosynthetic process
 IEA biological process
GO:2000641 regulation of early endos
ome to late endosome tran
sport
 IMP biological process
GO:2000811 negative regulation of an
oikis
 IMP biological process
GO:2001237 negative regulation of ex
trinsic apoptotic signali
ng pathway
 IMP biological process
GO:2001243 negative regulation of in
trinsic apoptotic signali
ng pathway
 IMP biological process
GO:2001286 regulation of caveolin-me
diated endocytosis
 IMP biological process
GO:0000166 nucleotide binding
 IEA molecular function
GO:0002223 stimulatory C-type lectin
receptor signaling pathw
ay
 TAS biological process
GO:0002376 immune system process
 IEA biological process
GO:0004672 protein kinase activity
 IEA molecular function
GO:0004672 protein kinase activity
 IEA molecular function
GO:0004672 protein kinase activity
 IDA molecular function
GO:0004672 protein kinase activity
 TAS molecular function
GO:0004672 protein kinase activity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 IEA molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 IEA molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 IEA molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 EXP molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 EXP molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 EXP molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 EXP molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 EXP molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 IDA molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 EXP molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 EXP molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 EXP molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 IDA molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 EXP molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004715 non-membrane spanning pro
tein tyrosine kinase acti
vity
 IEA molecular function
GO:0004715 non-membrane spanning pro
tein tyrosine kinase acti
vity
 TAS molecular function
GO:0005070 SH3/SH2 adaptor activity
 TAS molecular function
GO:0005080 protein kinase C binding
 IEA molecular function
GO:0005102 receptor binding
 IEA molecular function
GO:0005102 receptor binding
 IPI molecular function
GO:0005158 insulin receptor binding
 IEA molecular function
GO:0005178 integrin binding
 TAS molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005524 ATP binding
 IEA molecular function
GO:0005524 ATP binding
 IEA molecular function
GO:0005634 nucleus
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:0005739 mitochondrion
 IEA cellular component
GO:0005739 mitochondrion
 IDA cellular component
GO:0005743 mitochondrial inner membr
ane
 IEA cellular component
GO:0005743 mitochondrial inner membr
ane
 IEA cellular component
GO:0005743 mitochondrial inner membr
ane
 IDA cellular component
GO:0005764 lysosome
 IDA cellular component
GO:0005770 late endosome
 IDA cellular component
GO:0005829 cytosol
 IDA cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005856 cytoskeleton
 IEA cellular component
GO:0005856 cytoskeleton
 IEA cellular component
GO:0005884 actin filament
 IEA cellular component
GO:0005886 plasma membrane
 IEA cellular component
GO:0005886 plasma membrane
 IEA cellular component
GO:0005886 plasma membrane
 IEA cellular component
GO:0005886 plasma membrane
 IDA cellular component
GO:0005886 plasma membrane
 IDA cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005901 caveola
 IEA cellular component
GO:0005901 caveola
 IDA cellular component
GO:0006468 protein phosphorylation
 IEA biological process
GO:0006468 protein phosphorylation
 IEA biological process
GO:0007049 cell cycle
 IEA biological process
GO:0007155 cell adhesion
 IEA biological process
GO:0007165 signal transduction
 TAS biological process
GO:0007165 signal transduction
 TAS biological process
GO:0007172 signal complex assembly
 TAS biological process
GO:0007173 epidermal growth factor r
eceptor signaling pathway
 IEA biological process
GO:0007173 epidermal growth factor r
eceptor signaling pathway
 IBA biological process
GO:0007173 epidermal growth factor r
eceptor signaling pathway
 TAS biological process
GO:0007179 transforming growth facto
r beta receptor signaling
pathway
 IMP biological process
GO:0007229 integrin-mediated signali
ng pathway
 IMP biological process
GO:0007417 central nervous system de
velopment
 IBA biological process
GO:0008022 protein C-terminus bindin
g
 IEA molecular function
GO:0008283 cell proliferation
 IEA biological process
GO:0009612 response to mechanical st
imulus
 IEA biological process
GO:0009615 response to virus
 IEA biological process
GO:0010447 response to acidic pH
 IEA biological process
GO:0010628 positive regulation of ge
ne expression
 IEA biological process
GO:0010632 regulation of epithelial
cell migration
 IMP biological process
GO:0010634 positive regulation of ep
ithelial cell migration
 IMP biological process
GO:0010641 positive regulation of pl
atelet-derived growth fac
tor receptor signaling pa
thway
 IEA biological process
GO:0010907 positive regulation of gl
ucose metabolic process
 IEA biological process
GO:0014069 postsynaptic density
 IEA cellular component
GO:0014911 positive regulation of sm
ooth muscle cell migratio
n
 IEA biological process
GO:0016020 membrane
 IEA cellular component
GO:0016032 viral process
 IEA biological process
GO:0016301 kinase activity
 IEA molecular function
GO:0016301 kinase activity
 IEA molecular function
GO:0016301 kinase activity
 TAS molecular function
GO:0016310 phosphorylation
 IEA biological process
GO:0016310 phosphorylation
 IEA biological process
GO:0016337 single organismal cell-ce
ll adhesion
 IEA biological process
GO:0016477 cell migration
 IEA biological process
GO:0016740 transferase activity
 IEA molecular function
GO:0018105 peptidyl-serine phosphory
lation
 IEA biological process
GO:0018108 peptidyl-tyrosine phospho
rylation
 IEA biological process
GO:0018108 peptidyl-tyrosine phospho
rylation
 IDA biological process
GO:0019899 enzyme binding
 IEA molecular function
GO:0019899 enzyme binding
 IPI molecular function
GO:0019900 kinase binding
 IPI molecular function
GO:0019901 protein kinase binding
 IEA molecular function
GO:0019904 protein domain specific b
inding
 IEA molecular function
GO:0020037 heme binding
 IDA molecular function
GO:0022407 regulation of cell-cell a
dhesion
 IMP biological process
GO:0030168 platelet activation
 TAS biological process
GO:0030331 estrogen receptor binding
 IEA molecular function
GO:0030520 intracellular estrogen re
ceptor signaling pathway
 IBA biological process
GO:0030900 forebrain development
 IEA biological process
GO:0031234 extrinsic component of cy
toplasmic side of plasma
membrane
 IBA cellular component
GO:0031295 T cell costimulation
 TAS biological process
GO:0031295 T cell costimulation
 TAS biological process
GO:0031648 protein destabilization
 IEA biological process
GO:0031667 response to nutrient leve
ls
 IEA biological process
GO:0031954 positive regulation of pr
otein autophosphorylation
 IEA biological process
GO:0032148 activation of protein kin
ase B activity
 IEA biological process
GO:0032211 negative regulation of te
lomere maintenance via te
lomerase
 IMP biological process
GO:0032403 protein complex binding
 IEA molecular function
GO:0032463 negative regulation of pr
otein homooligomerization
 IMP biological process
GO:0032587 ruffle membrane
 IEA cellular component
GO:0032869 cellular response to insu
lin stimulus
 IEA biological process
GO:0033146 regulation of intracellul
ar estrogen receptor sign
aling pathway
 IEA biological process
GO:0033625 positive regulation of in
tegrin activation
 TAS biological process
GO:0034332 adherens junction organiz
ation
 IEA biological process
GO:0034446 substrate adhesion-depend
ent cell spreading
 IEA biological process
GO:0034614 cellular response to reac
tive oxygen species
 IEA biological process
GO:0035556 intracellular signal tran
sduction
 IEA biological process
GO:0035556 intracellular signal tran
sduction
 IDA biological process
GO:0035556 intracellular signal tran
sduction
 TAS biological process
GO:0036035 osteoclast development
 IEA biological process
GO:0036035 osteoclast development
 IBA biological process
GO:0036120 cellular response to plat
elet-derived growth facto
r stimulus
 IEA biological process
GO:0038083 peptidyl-tyrosine autopho
sphorylation
 IBA biological process
GO:0038096 Fc-gamma receptor signali
ng pathway involved in ph
agocytosis
 TAS biological process
GO:0038128 ERBB2 signaling pathway
 TAS biological process
GO:0042127 regulation of cell prolif
eration
 IBA biological process
GO:0042169 SH2 domain binding
 IPI molecular function
GO:0042493 response to drug
 IEA biological process
GO:0042542 response to hydrogen pero
xide
 IEA biological process
GO:0043005 neuron projection
 IEA cellular component
GO:0043065 positive regulation of ap
optotic process
 IEA biological process
GO:0043066 negative regulation of ap
optotic process
 IMP biological process
GO:0043114 regulation of vascular pe
rmeability
 TAS biological process
GO:0043149 stress fiber assembly
 IMP biological process
GO:0043154 negative regulation of cy
steine-type endopeptidase
activity involved in apo
ptotic process
 IMP biological process
GO:0043393 regulation of protein bin
ding
 IEA biological process
GO:0043406 positive regulation of MA
P kinase activity
 IEA biological process
GO:0043552 positive regulation of ph
osphatidylinositol 3-kina
se activity
 IEA biological process
GO:0044325 ion channel binding
 IEA molecular function
GO:0044325 ion channel binding
 IPI molecular function
GO:0044325 ion channel binding
 IPI molecular function
GO:0045056 transcytosis
 IEA biological process
GO:0045087 innate immune response
 IBA biological process
GO:0045124 regulation of bone resorp
tion
 TAS biological process
GO:0045453 bone resorption
 IEA biological process
GO:0045453 bone resorption
 ISS biological process
GO:0045737 positive regulation of cy
clin-dependent protein se
rine/threonine kinase act
ivity
 IEA biological process
GO:0045785 positive regulation of ce
ll adhesion
 IEA biological process
GO:0045892 negative regulation of tr
anscription, DNA-template
d
 IEA biological process
GO:0045893 positive regulation of tr
anscription, DNA-template
d
 IEA biological process
GO:0046628 positive regulation of in
sulin receptor signaling
pathway
 IEA biological process
GO:0046777 protein autophosphorylati
on
 IEA biological process
GO:0046777 protein autophosphorylati
on
 IDA biological process
GO:0046875 ephrin receptor binding
 IEA molecular function
GO:0046875 ephrin receptor binding
 IPI molecular function
GO:0048008 platelet-derived growth f
actor receptor signaling
pathway
 IBA biological process
GO:0048010 vascular endothelial grow
th factor receptor signal
ing pathway
 TAS biological process
GO:0048011 neurotrophin TRK receptor
signaling pathway
 IEA biological process
GO:0048013 ephrin receptor signaling
pathway
 TAS biological process
GO:0048471 perinuclear region of cyt
oplasm
 IEA cellular component
GO:0048477 oogenesis
 IEA biological process
GO:0050715 positive regulation of cy
tokine secretion
 IEA biological process
GO:0050731 positive regulation of pe
ptidyl-tyrosine phosphory
lation
 IC biological process
GO:0050839 cell adhesion molecule bi
nding
 IEA molecular function
GO:0050847 progesterone receptor sig
naling pathway
 IEA biological process
GO:0050847 progesterone receptor sig
naling pathway
 ISS biological process
GO:0050847 progesterone receptor sig
naling pathway
 IBA biological process
GO:0050900 leukocyte migration
 TAS biological process
GO:0051219 phosphoprotein binding
 IPI molecular function
GO:0051222 positive regulation of pr
otein transport
 IEA biological process
GO:0051385 response to mineralocorti
coid
 IEA biological process
GO:0051427 hormone receptor binding
 IBA molecular function
GO:0051602 response to electrical st
imulus
 IEA biological process
GO:0051726 regulation of cell cycle
 IBA biological process
GO:0051895 negative regulation of fo
cal adhesion assembly
 IEA biological process
GO:0051895 negative regulation of fo
cal adhesion assembly
 ISS biological process
GO:0051897 positive regulation of pr
otein kinase B signaling
 IMP biological process
GO:0051902 negative regulation of mi
tochondrial depolarizatio
n
 IMP biological process
GO:0051974 negative regulation of te
lomerase activity
 IMP biological process
GO:0060065 uterus development
 IEA biological process
GO:0060444 branching involved in mam
mary gland duct morphogen
esis
 IEA biological process
GO:0060491 regulation of cell projec
tion assembly
 IEA biological process
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
 IEA biological process
GO:0070542 response to fatty acid
 IEA biological process
GO:0070555 response to interleukin-1
 IMP biological process
GO:0070851 growth factor receptor bi
nding
 IPI molecular function
GO:0071222 cellular response to lipo
polysaccharide
 IEA biological process
GO:0071375 cellular response to pept
ide hormone stimulus
 IEA biological process
GO:0071375 cellular response to pept
ide hormone stimulus
 ISS biological process
GO:0071393 cellular response to prog
esterone stimulus
 IEA biological process
GO:0071393 cellular response to prog
esterone stimulus
 ISS biological process
GO:0071398 cellular response to fatt
y acid
 IEA biological process
GO:0071456 cellular response to hypo
xia
 IEA biological process
GO:0071498 cellular response to flui
d shear stress
 IEA biological process
GO:0071560 cellular response to tran
sforming growth factor be
ta stimulus
 IEA biological process
GO:0071801 regulation of podosome as
sembly
 IBA biological process
GO:0071803 positive regulation of po
dosome assembly
 IEA biological process
GO:0071902 positive regulation of pr
otein serine/threonine ki
nase activity
 IDA biological process
GO:0086098 angiotensin-activated sig
naling pathway involved i
n heart process
 IEA biological process
GO:0086098 angiotensin-activated sig
naling pathway involved i
n heart process
 ISS biological process
GO:0090263 positive regulation of ca
nonical Wnt signaling pat
hway
 IEA biological process
GO:0097110 scaffold protein binding
 IEA molecular function
GO:0097110 scaffold protein binding
 IPI molecular function
GO:1902533 positive regulation of in
tracellular signal transd
uction
 IEA biological process
GO:2000394 positive regulation of la
mellipodium morphogenesis
 IMP biological process
GO:2000573 positive regulation of DN
A biosynthetic process
 IEA biological process
GO:2000641 regulation of early endos
ome to late endosome tran
sport
 IMP biological process
GO:2000811 negative regulation of an
oikis
 IMP biological process
GO:2001237 negative regulation of ex
trinsic apoptotic signali
ng pathway
 IMP biological process
GO:2001243 negative regulation of in
trinsic apoptotic signali
ng pathway
 IMP biological process
GO:2001286 regulation of caveolin-me
diated endocytosis
 IMP biological process
GO:0002223 stimulatory C-type lectin
receptor signaling pathw
ay
 TAS biological process
GO:0004672 protein kinase activity
 IDA molecular function
GO:0004672 protein kinase activity
 TAS molecular function
GO:0004672 protein kinase activity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 EXP molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 EXP molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 EXP molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 EXP molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 EXP molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 IDA molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 EXP molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 EXP molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 EXP molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 IDA molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 EXP molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004713 protein tyrosine kinase a
ctivity
 TAS molecular function
GO:0004715 non-membrane spanning pro
tein tyrosine kinase acti
vity
 TAS molecular function
GO:0005070 SH3/SH2 adaptor activity
 TAS molecular function
GO:0005102 receptor binding
 IPI molecular function
GO:0005178 integrin binding
 TAS molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005737 cytoplasm
 IDA cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:0005739 mitochondrion
 IDA cellular component
GO:0005743 mitochondrial inner membr
ane
 IDA cellular component
GO:0005764 lysosome
 IDA cellular component
GO:0005770 late endosome
 IDA cellular component
GO:0005829 cytosol
 IDA cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005886 plasma membrane
 IDA cellular component
GO:0005886 plasma membrane
 IDA cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005886 plasma membrane
 TAS cellular component
GO:0005901 caveola
 IDA cellular component
GO:0007165 signal transduction
 TAS biological process
GO:0007165 signal transduction
 TAS biological process
GO:0007172 signal complex assembly
 TAS biological process
GO:0007173 epidermal growth factor r
eceptor signaling pathway
 IBA biological process
GO:0007173 epidermal growth factor r
eceptor signaling pathway
 TAS biological process
GO:0007179 transforming growth facto
r beta receptor signaling
pathway
 IMP biological process
GO:0007229 integrin-mediated signali
ng pathway
 IMP biological process
GO:0007417 central nervous system de
velopment
 IBA biological process
GO:0010632 regulation of epithelial
cell migration
 IMP biological process
GO:0010634 positive regulation of ep
ithelial cell migration
 IMP biological process
GO:0016301 kinase activity
 TAS molecular function
GO:0018108 peptidyl-tyrosine phospho
rylation
 IDA biological process
GO:0019899 enzyme binding
 IPI molecular function
GO:0019900 kinase binding
 IPI molecular function
GO:0020037 heme binding
 IDA molecular function
GO:0022407 regulation of cell-cell a
dhesion
 IMP biological process
GO:0030168 platelet activation
 TAS biological process
GO:0030520 intracellular estrogen re
ceptor signaling pathway
 IBA biological process
GO:0031234 extrinsic component of cy
toplasmic side of plasma
membrane
 IBA cellular component
GO:0031295 T cell costimulation
 TAS biological process
GO:0031295 T cell costimulation
 TAS biological process
GO:0032211 negative regulation of te
lomere maintenance via te
lomerase
 IMP biological process
GO:0032463 negative regulation of pr
otein homooligomerization
 IMP biological process
GO:0033625 positive regulation of in
tegrin activation
 TAS biological process
GO:0035556 intracellular signal tran
sduction
 IDA biological process
GO:0035556 intracellular signal tran
sduction
 TAS biological process
GO:0036035 osteoclast development
 IBA biological process
GO:0038083 peptidyl-tyrosine autopho
sphorylation
 IBA biological process
GO:0038096 Fc-gamma receptor signali
ng pathway involved in ph
agocytosis
 TAS biological process
GO:0038128 ERBB2 signaling pathway
 TAS biological process
GO:0042127 regulation of cell prolif
eration
 IBA biological process
GO:0042169 SH2 domain binding
 IPI molecular function
GO:0043066 negative regulation of ap
optotic process
 IMP biological process
GO:0043114 regulation of vascular pe
rmeability
 TAS biological process
GO:0043149 stress fiber assembly
 IMP biological process
GO:0043154 negative regulation of cy
steine-type endopeptidase
activity involved in apo
ptotic process
 IMP biological process
GO:0044325 ion channel binding
 IPI molecular function
GO:0044325 ion channel binding
 IPI molecular function
GO:0045087 innate immune response
 IBA biological process
GO:0045124 regulation of bone resorp
tion
 TAS biological process
GO:0045453 bone resorption
 ISS biological process
GO:0046777 protein autophosphorylati
on
 IDA biological process
GO:0046875 ephrin receptor binding
 IPI molecular function
GO:0048008 platelet-derived growth f
actor receptor signaling
pathway
 IBA biological process
GO:0048010 vascular endothelial grow
th factor receptor signal
ing pathway
 TAS biological process
GO:0048013 ephrin receptor signaling
pathway
 TAS biological process
GO:0050731 positive regulation of pe
ptidyl-tyrosine phosphory
lation
 IC biological process
GO:0050847 progesterone receptor sig
naling pathway
 ISS biological process
GO:0050847 progesterone receptor sig
naling pathway
 IBA biological process
GO:0050900 leukocyte migration
 TAS biological process
GO:0051219 phosphoprotein binding
 IPI molecular function
GO:0051427 hormone receptor binding
 IBA molecular function
GO:0051726 regulation of cell cycle
 IBA biological process
GO:0051895 negative regulation of fo
cal adhesion assembly
 ISS biological process
GO:0051897 positive regulation of pr
otein kinase B signaling
 IMP biological process
GO:0051902 negative regulation of mi
tochondrial depolarizatio
n
 IMP biological process
GO:0051974 negative regulation of te
lomerase activity
 IMP biological process
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070555 response to interleukin-1
 IMP biological process
GO:0070851 growth factor receptor bi
nding
 IPI molecular function
GO:0071375 cellular response to pept
ide hormone stimulus
 ISS biological process
GO:0071393 cellular response to prog
esterone stimulus
 ISS biological process
GO:0071801 regulation of podosome as
sembly
 IBA biological process
GO:0071902 positive regulation of pr
otein serine/threonine ki
nase activity
 IDA biological process
GO:0086098 angiotensin-activated sig
naling pathway involved i
n heart process
 ISS biological process
GO:0097110 scaffold protein binding
 IPI molecular function
GO:2000394 positive regulation of la
mellipodium morphogenesis
 IMP biological process
GO:2000641 regulation of early endos
ome to late endosome tran
sport
 IMP biological process
GO:2000811 negative regulation of an
oikis
 IMP biological process
GO:2001237 negative regulation of ex
trinsic apoptotic signali
ng pathway
 IMP biological process
GO:2001243 negative regulation of in
trinsic apoptotic signali
ng pathway
 IMP biological process
GO:2001286 regulation of caveolin-me
diated endocytosis
 IMP biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa00052Galactose metabolism
hsa00620Pyruvate metabolism
hsa00640Propanoate metabolism
hsa00590Arachidonic acid metabolism
hsa00230Purine metabolism
hsa00310Lysine degradation
hsa00310Lysine degradation
hsa00220Arginine biosynthesis
hsa00330Arginine and proline metabolism
hsa00350Tyrosine metabolism
hsa00472D-Arginine and D-ornithine metabolism
hsa00480Glutathione metabolism
hsa00980Metabolism of xenobiotics by cytochrome P450
hsa00983Drug metabolism - other enzymes
hsa03040Spliceosome
hsa03040Spliceosome
hsa00970Aminoacyl-tRNA biosynthesis
hsa03013RNA transport
hsa03013RNA transport
hsa03008Ribosome biogenesis in eukaryotes
hsa04141Protein processing in endoplasmic reticulum
hsa04141Protein processing in endoplasmic reticulum
hsa03410Base excision repair
hsa03430Mismatch repair
hsa04014Ras signaling pathway
hsa04010MAPK signaling pathway
hsa04012ErbB signaling pathway
hsa04012ErbB signaling pathway
hsa04310Wnt signaling pathway
hsa04310Wnt signaling pathway
hsa04340Hedgehog signaling pathway
hsa04390Hippo signaling pathway
hsa04370VEGF signaling pathway
hsa04371Apelin signaling pathway
hsa04371Apelin signaling pathway
hsa04630JAK-STAT signaling pathway
hsa04064NF-kappa B signaling pathway
hsa04144Endocytosis
hsa04137Mitophagy - animal
hsa04510Focal adhesion
hsa04520Adherens junction
hsa04530Tight junction
hsa04540Gap junction
hsa04810Regulation of actin cytoskeleton
hsa04611Platelet activation
hsa04625C-type lectin receptor signaling pathway
hsa04062Chemokine signaling pathway
hsa04912GnRH signaling pathway
hsa04915Estrogen signaling pathway
hsa04917Prolactin signaling pathway
hsa04921Oxytocin signaling pathway
hsa04926Relaxin signaling pathway
hsa04919Thyroid hormone signaling pathway
hsa04727GABAergic synapse
hsa04750Inflammatory mediator regulation of TRP channels
hsa04360Axon guidance
hsa05205Proteoglycans in cancer
hsa05203Viral carcinogenesis
hsa05219Bladder cancer
hsa05418Fluid shear stress and atherosclerosis
hsa05120Epithelial cell signaling in Helicobacter pylori infection
hsa05131Shigellosis
hsa05135Yersinia infection
hsa05152Tuberculosis
hsa05100Bacterial invasion of epithelial cells
hsa05161Hepatitis B
hsa05168Herpes simplex virus 1 infection
hsa05163Human cytomegalovirus infection
hsa05167Kaposi sarcoma-associated herpesvirus infection
hsa01521EGFR tyrosine kinase inhibitor resistance
hsa01522Endocrine resistance

Diseases

Expand All | Collapse All
Associated diseases References
Cancer (thyroid) GAD: 19730683
Thrombocytopenia KEGG: H00978
Bone diseases GAD: 19453261
Endometriosis INFBASE: 24972189
Ovarian endometriosis INFBASE: 21518137
Male factor infertility MIK: 23397631
Spermatogenesis defects MIK: 23397631
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Cryptorchidism MIK: 28606200
Hypospermatogenesis MIK: 28361989
Spermatogenic defects MIK: 18753142
Spermatogenesis MIK: 23397631

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
23397631 Spermatoge
nesis

Male infertility c-Src
c-Yes
 Show abstract
18753142 Regulates
sperm capa
citation,
calcium fl
uxes, tyro
sine phosp
horylation
and acros
ome reacti
on

Male infertility
Show abstract
7530000 Involved i
n rat sper
matogenesi
s

Male infertility
Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract
28606200 Cryptorchi
dism
Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
 Male infertility MeDIP-Seq
 Show abstract
28361989 Hyposperma
togenesis
6 (3 controls,
3 Klienfelter s
yndrome
 Male infertility Microarray
 Show abstract