• Gene id: 6701

Gene Summary

• Gene Symbol: SPRR2B   Gene   UCSC   Ensembl
• Gene name: small proline rich protein 2B
• Alternate names: small proline-rich protein 2B, SPR-2B,
• Gene location: 1q21.3 (153071610: 153070225)     Exons: 2     NC_000001.11
• OMIM: 182268

Protein Summary

• Protein general information: P35325  
  • Name: Small proline rich protein 2B (SPR 2B)
  • Length: 72  
  • Mass: 7975
  • Tissue specificity: Suprabasal layers of squamous-differentiated tissues such as epidermis, esophagus, tongue and trachea.
• Sequence:

  MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK

• Structural information:
  • Interpro: IPR026075  IPR029142  
  • STRING: ENSP00000357744
• Other Databases: GeneCards:  SPRR2B  Malacards:  SPRR2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001533	cornified envelope	IEA	cellular component
GO:0031424	keratinization	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0001533	cornified envelope	TAS	cellular component
GO:0070268	cornification	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008544	epidermis development	NAS	biological process
GO:0030216	keratinocyte differentiation	NAS	biological process
GO:0001533	cornified envelope	NAS	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)