• Gene id: 6699

Gene Summary

• Gene Symbol: SPRR1B   Gene   UCSC   Ensembl
• Aliases: CORNIFIN, GADD33, SPR-IB, SPRR1
• Gene name: small proline rich protein 1B
• Alternate names: cornifin-B, 14.9 kDa pancornulin, small proline-rich protein IB,
• Gene location: 1q21.3 (153031202: 153032899)     Exons: 2     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is an envelope protein of keratinocytes. The encoded protein is crosslinked to membrane proteins by transglutaminase, forming an insoluble layer under the plasma membrane. This protein is proline-rich and contains several
• OMIM: 137295

Protein Summary

• Protein general information: P22528  
  • Name: Cornifin B (14.9 kDa pancornulin) (Small proline rich protein IB) (SPR IB)
  • Length: 89  
  • Mass: 9888
  • Tissue specificity: Suprabasal layers of squamous-differentiated tissues such as epidermis, esophagus, tongue and trachea.
• Sequence:

  MSSQQQKQPCTPPPQLQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCHPKVPEPCPS
  IVTPAPAQQKTKQK

• Structural information:
  • Interpro: IPR003302  IPR026075  
  • STRING: ENSP00000306461
• Other Databases: GeneCards:  SPRR1B  Malacards:  SPRR1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IEA	cellular component
GO:0018149	peptide cross-linking	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0031424	keratinization	IEA	biological process
GO:0005198	structural molecule activity	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0008544	epidermis development	TAS	biological process
GO:0001533	cornified envelope	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0070268	cornification	TAS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0030216	keratinocyte differentiation	IDA	biological process
GO:0001533	cornified envelope	IDA	cellular component
GO:0018149	peptide cross-linking	IDA	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R