• Gene id: 6696

Gene Summary

• Gene Symbol: SPP1   Gene   UCSC   Ensembl
• Aliases: BNSP, BSPI, ETA-1, OPN
• Gene name: secreted phosphoprotein 1
• Alternate names: osteopontin, SPP1/CALPHA1 fusion, early T-lymphocyte activation 1, nephropontin, osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein, secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1), secret,
• Gene location: 4q22.1 (173519143: 173384700)     Exons: 5     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. The encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane an
• OMIM: 166490

Protein Summary

• Protein general information: P10451  
  • Name: Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP 1) (Urinary stone protein) (Uropontin)
  • Length: 314  
  • Mass: 35423
  • Tissue specificity: Bone. Found in plasma.
• Sequence:

  MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETLP
  SKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVV
  PTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSY
  ETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKF
  RISHELDSASSEVN

• Structural information:
  • Interpro: IPR002038  IPR019841  
  • Prosite: PS00884
  • PDB: 3CXD 3DSF
  • PDBsum: 3CXD 3DSF
  • DIP: 49933
  • STRING: ENSP00000378517
• Other Databases: GeneCards:  SPP1  Malacards:  SPP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007155	cell adhesion	IDA	biological process
GO:0005178	integrin binding	IPI	molecular function
GO:0050840	extracellular matrix binding	IBA	molecular function
GO:0045780	positive regulation of bone resorption	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0001649	osteoblast differentiation	IBA	biological process
GO:0007155	cell adhesion	IBA	biological process
GO:0001503	ossification	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0031214	biomineral tissue development	IEA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048685	negative regulation of collateral sprouting of intact axon in response to injury	IEA	biological process
GO:0031982	vesicle	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0048545	response to steroid hormone	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0045780	positive regulation of bone resorption	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0010033	response to organic substance	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0001649	osteoblast differentiation	IEA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0007566	embryo implantation	TAS	biological process
GO:0033280	response to vitamin D	IDA	biological process
GO:0046697	decidualization	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0006710	androgen catabolic process	IDA	biological process
GO:2000866	positive regulation of estradiol secretion	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0071394	cellular response to testosterone stimulus	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa04510	Focal adhesion
hsa04371	Apelin signaling pathway
hsa04512	ECM-receptor interaction
hsa04620	Toll-like receptor signaling pathway
hsa04929	GnRH secretion

Diseases

Associated diseases	References
Progressive osseous heteroplasia	PMID:18422975
Prostate cancer	PMID:16331611
Kidney failure	PMID:21034455
urinary bladder cancer	PMID:21483670
Biliary atresia	PMID:15845635
pancreatic cancer	PMID:15970685
Calcinosis	PMID:18422975
Melanoma	PMID:15757900
Multiple sclerosis	PMID:11721059
Multiple sclerosis	PMID:15885319
Coronary artery disease	PMID:21034455
lung non-small cell carcinoma	PMID:16533775
Coronary restenosis	PMID:16373617
Myocardial infarction	PMID:12939547
hepatocellular carcinoma	PMID:16047475
Rheumatoid arthritis	PMID:15761492
multiple myeloma	PMID:16208410
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881