• Gene id: 6695

Gene Summary

• Gene Symbol: SPOCK1   Gene   UCSC   Ensembl
• Aliases: SPOCK, TESTICAN, TIC1
• Gene name: SPARC (osteonectin), cwcv and kazal like domains proteoglycan 1
• Alternate names: testican-1, SPARC/osteonectin, cwcv and kazal like domains proteoglycan 1, sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 1,
• Gene location: 5q31.2 (137499325: 136975297)     Exons: 11     NC_000005.10
• Gene summary(Entrez): This gene encodes the protein core of a seminal plasma proteoglycan containing chondroitin- and heparan-sulfate chains. The protein's function is unknown, although similarity to thyropin-type cysteine protease-inhibitors suggests its function may be relat
• OMIM: 602264

Protein Summary

• Protein general information: Q08629  
  • Name: Testican 1 (Protein SPOCK)
  • Length: 439  
  • Mass: 49124
• Sequence:

  MPAIAVLAAAAAAWCFLQVESRHLDALAGGAGPNHGNFLDNDQWLSTVSQYDRDKYWNRFRDDDYFRNWNPNKPF
  DQALDPSKDPCLKVKCSPHKVCVTQDYQTALCVSRKHLLPRQKKGNVAQKHWVGPSNLVKCKPCPVAQSAMVCGS
  DGHSYTSKCKLEFHACSTGKSLATLCDGPCPCLPEPEPPKHKAERSACTDKELRNLASRLKDWFGALHEDANRVI
  KPTSSNTAQGRFDTSILPICKDSLGWMFNKLDMNYDLLLDPSEINAIYLDKYEPCIKPLFNSCDSFKDGKLSNNE
  WCYCFQKPGGLPCQNEMNRIQKLSKGKSLLGAFIPRCNEEGYYKATQCHGSTGQCWCVDKYGNELAGSRKQGAVS
  CEEEQETSGDFGSGGSVVLLDDLEYERELGPKDKEGKLRVHTRAVTEDDEDEDDDKEDEVGYIW

• Structural information:
  • Protein Domains: (130..18-)
    (/note="Kazal-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00798-)
    (310..37-)
    (/note="Thyroglobulin-type-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00500"-)
  • Interpro: IPR011992  IPR002350  IPR036058  IPR019577  IPR000716   IPR036857  
  • Prosite: PS51465 PS00484 PS51162
  • CDD: cd00191
  • STRING: ENSP00000378401
• Other Databases: GeneCards:  SPOCK1  Malacards:  SPOCK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050840	extracellular matrix binding	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0005509	calcium ion binding	IBA	molecular function
GO:0048856	anatomical structure development	IBA	biological process
GO:0005518	collagen binding	IBA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008191	metalloendopeptidase inhibitor activity	IDA	molecular function
GO:0004869	cysteine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005509	calcium ion binding	IDA	molecular function
GO:0010977	negative regulation of neuron projection development	IDA	biological process
GO:0010951	negative regulation of endopeptidase activity	IDA	biological process
GO:0010812	negative regulation of cell-substrate adhesion	IDA	biological process
GO:0022008	neurogenesis	ISS	biological process
GO:0016528	sarcoplasm	ISS	cellular component
GO:0001558	regulation of cell growth	NAS	biological process
GO:0031594	neuromuscular junction	ISS	cellular component
GO:0014069	postsynaptic density	NAS	cellular component
GO:0007399	nervous system development	NAS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0004867	serine-type endopeptidase inhibitor activity	NAS	molecular function
GO:0033268	node of Ranvier	ISS	cellular component
GO:0001764	neuron migration	ISS	biological process
GO:0021953	central nervous system neuron differentiation	ISS	biological process
GO:0007155	cell adhesion	NAS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq