• Gene id: 6694

Gene Summary

• Gene Symbol: SPP2   Gene   UCSC   Ensembl
• Aliases: SPP-24, SPP24
• Gene name: secreted phosphoprotein 2
• Alternate names: secreted phosphoprotein 24, secreted phosphoprotein 2, 24kD, secreted phosphoprotein 2, 24kDa,
• Gene location: 2q37.1 (234050666: 234077133)     Exons: 10     NC_000002.12
• Gene summary(Entrez): This gene encodes a secreted phosphoprotein that is a member of the cystatin superfamily. [provided by RefSeq, Oct 2008]
• OMIM: 604741

Protein Summary

• Protein general information: Q13103  
  • Name: Secreted phosphoprotein 24 (Spp 24) (Secreted phosphoprotein 2)
  • Length: 211  
  • Mass: 24338
  • Tissue specificity: Detected in liver and plasma. {ECO
• Sequence:

  MISRMEKMTMMMKILIMFALGMNYWSCSGFPVYDYDPSSLRDALSASVVKVNSQSLSPYLFRAFRSSLKRVEVLD
  ENNLVMNLEFSIRETTCRKDSGEDPATCAFQRDYYVSTAVCRSTVKVSAQQVQGVHARCSWSSSTSESYSSEEMI
  FGDMLGSHKWRNNYLFGLISDESISEQFYDRSLGIMRRVLPPGNRRYPNHRHRARINTDFE

• Structural information:
  • Interpro: IPR010892  
  • STRING: ENSP00000168148
• Other Databases: GeneCards:  SPP2  Malacards:  SPP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0046849	bone remodeling	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0004866	endopeptidase inhibitor activity	TAS	molecular function
GO:0001501	skeletal system development	TAS	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0031089	platelet dense granule lumen	TAS	cellular component
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq