• Gene id: 6690

Gene Summary

• Gene Symbol: SPINK1   Gene   UCSC   Ensembl
• Aliases: PCTT, PSTI, Spink3, TATI, TCP
• Gene name: serine peptidase inhibitor, Kazal type 1
• Alternate names: serine protease inhibitor Kazal-type 1, pancreatic secretory trypsin inhibitor, serine protease inhibitor, Kazal type 1, tumor-associated trypsin inhibitor,
• Gene location: 5q32 (147839230: 147824579)     Exons: 5     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pa
• OMIM: 167790

Protein Summary

• Protein general information: P00995  
  • Name: Serine protease inhibitor Kazal type 1 (Pancreatic secretory trypsin inhibitor) (Tumor associated trypsin inhibitor) (TATI)
  • Length: 79  
  • Mass: 8,507
• Sequence:

  MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQK
  SGPC

• Structural information:
  • Protein Domains: Kazal-like. (26-79)
  • Interpro: IPR002350  IPR036058  IPR001239  
  • Prosite: PS00282 PS51465
  • PDB: 1CGI 1CGJ 1HPT
  • PDBsum: 1CGI 1CGJ 1HPT
  • STRING: ENSP00000296695
• Other Databases: GeneCards:  SPINK1  Malacards:  SPINK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001669	acrosomal vesicle	IBA	cellular component
GO:0004866	endopeptidase inhibitor activity	TAS	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0010751	negative regulation of nitric oxide mediated signal transduction	IEA	biological process
GO:0050732	negative regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0060046	regulation of acrosome reaction	IBA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0090281	negative regulation of calcium ion import	IEA	biological process
GO:1900004	negative regulation of serine-type endopeptidase activity	IBA	biological process
GO:2001256	regulation of store-operated calcium entry	IEA	biological process
GO:0001669	acrosomal vesicle	IBA	cellular component
GO:0004866	endopeptidase inhibitor activity	TAS	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IBA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0010751	negative regulation of nitric oxide mediated signal transduction	IEA	biological process
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0050732	negative regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0060046	regulation of acrosome reaction	IEA	biological process
GO:0060046	regulation of acrosome reaction	IBA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0090281	negative regulation of calcium ion import	IEA	biological process
GO:1900004	negative regulation of serine-type endopeptidase activity	IEA	biological process
GO:1900004	negative regulation of serine-type endopeptidase activity	IBA	biological process
GO:2001256	regulation of store-operated calcium entry	IEA	biological process
GO:0001669	acrosomal vesicle	IBA	cellular component
GO:0004866	endopeptidase inhibitor activity	TAS	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0060046	regulation of acrosome reaction	IBA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:1900004	negative regulation of serine-type endopeptidase activity	IBA	biological process

Diseases

Associated diseases	References
Cancer	GAD: 17072959
Cancer (pancreatic)	GAD: 14688470
Cystic fibrosis	GAD: 20977904
Hyperparathyroidism	GAD: 18076731
Celiac disease	GAD: 17333166
Pancreatitis	OMIM: 167790
Diabetes	GAD: 15910626
Fatty liver	GAD: 19502653
Fibrocalculous pancreatic diabetes	OMIM: 167790
Hyperlipidemias	GAD: 17981921
Kidney diseases	GAD: 19578796
Unexplained infertility	MIK: 1780692
Endometriosis	INFBASE: 8988701
Calcinosis	GAD: 18706099
Hereditary pancreatitis	KEGG: H00933
Tropical calcific pancreatitis	KEGG: H00932
Unexplained infertility	MIK: 1780692

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
1780692	Unexplained infertility				Male infertility	TATI