• Gene id: 6677

Gene Summary

• Gene Symbol: SPAM1   Gene   UCSC   Ensembl
• Aliases: HEL-S-96n, HYA1, HYAL1, HYAL3, HYAL5, PH-20, PH20, SPAG15
• Gene name: sperm adhesion molecule 1
• Alternate names: hyaluronidase PH-20, PH-20 hyaluronidase, epididymis secretory sperm binding protein Li 96n, hyal-PH20, hyaluronoglucosaminidase PH-20, sperm adhesion molecule 1 (PH-20 hyaluronidase, zona pellucida binding), sperm surface protein PH-20,
• Gene location: 7q31.32 (123925231: 123971409)     Exons: 9     NC_000007.14
• Gene summary(Entrez): Hyaluronidase degrades hyaluronic acid, a major structural proteoglycan found in extracellular matrices and basement membranes. Six members of the hyaluronidase family are clustered into two tightly linked groups on chromosome 3p21.3 and 7q31.3. This gene
• OMIM: 600930

Protein Summary

• Protein general information: P38567  
  • Name: Hyaluronidase PH 20 (Hyal PH20) (EC 3.2.1.35) (Hyaluronoglucosaminidase PH 20) (Sperm adhesion molecule 1) (Sperm surface protein PH 20)
  • Length: 509  
  • Mass: 57,848
• Sequence:

  MGVLKFKHIFFRSFVKSSGVSQIVFTFLLIPCCLTLNFRAPPVIPNVPFLWAWNAPSEFCLGKFDEPLDMSLFSF
  IGSPRINATGQGVTIFYVDRLGYYPYIDSITGVTVNGGIPQKISLQDHLDKAKKDITFYMPVDNLGMAVIDWEEW
  RPTWARNWKPKDVYKNRSIELVQQQNVQLSLTEATEKAKQEFEKAGKDFLVETIKLGKLLRPNHLWGYYLFPDCY
  NHHYKKPGYNGSCFNVEIKRNDDLSWLWNESTALYPSIYLNTQQSPVAATLYVRNRVREAIRVSKIPDAKSPLPV
  FAYTRIVFTDQVLKFLSQDELVYTFGETVALGASGIVIWGTLSIMRSMKSCLLLDNYMETILNPYIINVTLAAKM
  CSQVLCQEQGVCIRKNWNSSDYLHLNPDNFAIQLEKGGKFTVRGKPTLEDLEQFSEKFYCSCYSTLSCKEKADVK
  DTDAVDVCIADGVCIDAFLKPPMETEEPQIFYNASPSTLSATMFIVSILFLIISSVASL

• Structural information:
  • Interpro: IPR013785  IPR017853  IPR018155  IPR001439  
  • STRING: ENSP00000345849
• Other Databases: GeneCards:  SPAM1  Malacards:  SPAM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004415	hyalurononglucosaminidase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0007339	binding of sperm to zona pellucida	TAS	biological process
GO:0007342	fusion of sperm to egg plasma membrane	IEA	biological process
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0035036	sperm-egg recognition	TAS	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0004415	hyalurononglucosaminidase activity	IEA	molecular function
GO:0004415	hyalurononglucosaminidase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0005975	carbohydrate metabolic process	TAS	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0007339	binding of sperm to zona pellucida	TAS	biological process
GO:0007342	fusion of sperm to egg plasma membrane	IEA	biological process
GO:0008152	metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016798	hydrolase activity, acting on glycosyl bonds	IEA	molecular function
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0035036	sperm-egg recognition	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005975	carbohydrate metabolic process	TAS	biological process
GO:0007339	binding of sperm to zona pellucida	TAS	biological process
GO:0035036	sperm-egg recognition	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways

Diseases

Associated diseases	References
Cleft defects	GAD: 20634891
Male factor infertility	MIK: 23209833
Male infertility	MIK: 23209833
Fertilization defects	MIK: 9154509
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
23209833	Male infertility				Male infertility
16436526	Sperm maturation				Male infertility
9154509	Role in fertilization				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R