• Gene id: 6670

Gene Summary

• Gene Symbol: SP3   Gene   UCSC   Ensembl
• Aliases: SPR2
• Gene name: Sp3 transcription factor
• Alternate names: transcription factor Sp3, GC-binding transcription factor Sp3, specificity protein 3,
• Gene location: 2q31.1 (126670509: 126424996)     Exons: 19     NC_000010.11
• Gene summary(Entrez): This gene belongs to a family of Sp1 related genes that encode transcription factors that regulate transcription by binding to consensus GC- and GT-box regulatory elements in target genes. This protein contains a zinc finger DNA-binding domain and several
• OMIM: 601804

Protein Summary

• Protein general information: Q02447  
  • Name: Transcription factor Sp3 (SPR 2)
  • Length: 781  
  • Mass: 81925
  • Tissue specificity: Ubiquitously expressed.
• Sequence:

  MTAPEKPVKQEEMAALDVDSGGGGGGGGGHGEYLQQQQQHGNGAVAAAAAAQDTQPSPLALLAATCSKIGPPSPG
  DDEEEAAAAAGAPAAAGATGDLASAQLGGAPNRWEVLSATPTTIKDEAGNLVQIPSAATSSGQYVLPLQNLQNQQ
  IFSVAPGSDSSNGTVSSVQYQVIPQIQSADGQQVQIGFTGSSDNGGINQESSQIQIIPGSNQTLLASGTPSANIQ
  NLIPQTGQVQVQGVAIGGSSFPGQTQVVANVPLGLPGNITFVPINSVDLDSLGLSGSSQTMTAGINADGHLINTG
  QAMDSSDNSERTGERVSPDINETNTDTDLFVPTSSSSQLPVTIDSTGILQQNTNSLTTSSGQVHSSDLQGNYIQS
  PVSEETQAQNIQVSTAQPVVQHLQLQESQQPTSQAQIVQGITPQTIHGVQASGQNISQQALQNLQLQLNPGTFLI
  QAQTVTPSGQVTWQTFQVQGVQNLQNLQIQNTAAQQITLTPVQTLTLGQVAAGGAFTSTPVSLSTGQLPNLQTVT
  VNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQHQEGKRLRRVAC
  TCPNCKEGGGRGTNLGKKKQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFVCNWMYCGKRFTRSDELQRHRRTH
  TGEKKFVCPECSKRFMRSDHLAKHIKTHQNKKGIHSSSTVLASVEAARDDTLITAGGTTLILANIQQGSVSGIGT
  VNTSATSNQDILTNTEIPLQLVTVSGNETME

• Structural information:
  • Interpro: IPR030452  IPR036236  IPR013087  
  • Prosite: PS00028 PS50157
  • STRING: ENSP00000310301
• Other Databases: GeneCards:  SP3  Malacards:  SP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000987	cis-regulatory region sequence-specific DNA binding	ISS	molecular function
GO:0032993	protein-DNA complex	ISS	cellular component
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0000987	cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048596	embryonic camera-type eye morphogenesis	IEA	biological process
GO:0043353	enucleate erythrocyte differentiation	IEA	biological process
GO:0030324	lung development	IEA	biological process
GO:0030224	monocyte differentiation	IEA	biological process
GO:0030217	T cell differentiation	IEA	biological process
GO:0017053	transcription repressor complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0001892	embryonic placenta development	IEA	biological process
GO:0001889	liver development	IEA	biological process
GO:0001829	trophectodermal cell differentiation	IEA	biological process
GO:0001779	natural killer cell differentiation	IEA	biological process
GO:0001701	in utero embryonic development	IEA	biological process
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA	molecular function
GO:0000987	cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0017053	transcription repressor complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA	molecular function
GO:0000987	cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0060216	definitive hemopoiesis	IEA	biological process
GO:0060136	embryonic process involved in female pregnancy	IEA	biological process
GO:0048706	embryonic skeletal system development	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0030851	granulocyte differentiation	IEA	biological process
GO:0030219	megakaryocyte differentiation	IEA	biological process
GO:0030218	erythrocyte differentiation	IEA	biological process
GO:0030183	B cell differentiation	IEA	biological process
GO:0003690	double-stranded DNA binding	IEA	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0001503	ossification	IEA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0032993	protein-DNA complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016605	PML body	IEA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0006355	regulation of transcription, DNA-templated	IDA	biological process
GO:0005634	nucleus	IC	cellular component
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	NAS	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	NAS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IGI	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process

KEGG pathways

Pathway id	Pathway name
P06959	CCKR signaling map
P06959	CCKR signaling map

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881