• Gene id: 6666

Gene Summary

• Gene Symbol: SOX12   Gene   UCSC   Ensembl
• Aliases: SOX22
• Gene name: SRY-box transcription factor 12
• Alternate names: transcription factor SOX-12, SOX-22 protein, SRY (sex determining region Y)-box 12, SRY-box 12, SRY-related HMG-box gene 22,
• Gene location: 20p13 (147928373: 147993591)     Exons: 17     NC_000001.11
• Gene summary(Entrez): Members of the SOX family of transcription factors are characterized by the presence of a DNA-binding high mobility group (HMG) domain, homologous to the HMG box of sex-determining region Y (SRY). Forming a subgroup of the HMG domain superfamily, SOX prot
• OMIM: 601947

Protein Summary

• Protein general information: O15370  
  • Name: Transcription factor SOX 12 (Protein SOX 22)
  • Length: 315  
  • Mass: 34122
  • Tissue specificity: Expressed most abundantly in the CNS (PubMed
• Sequence:

  MVQQRGARAKRDGGPPPPGPGPAEEGAREPGWCKTPSGHIKRPMNAFMVWSQHERRKIMDQWPDMHNAEISKRLG
  RRWQLLQDSEKIPFVREAERLRLKHMADYPDYKYRPRKKSKGAPAKARPRPPGGSGGGSRLKPGPQLPGRGGRRA
  AGGPLGGGAAAPEDDDEDDDEELLEVRLVETPGRELWRMVPAGRAARGQAERAQGPSGEGAAAAAAASPTPSEDE
  EPEEEEEEAAAAEEGEEETVASGEESLGFLSRLPPGPAGLDCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIA
  GDWRPSSIADLVFTY

• Structural information:
  • Interpro: IPR009071  IPR036910  IPR017386  IPR031267  
  • Prosite: PS50118
  • STRING: ENSP00000347646
• Other Databases: GeneCards:  SOX12  Malacards:  SOX12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0030154	cell differentiation	IBA	biological process
GO:0009653	anatomical structure morphogenesis	IBA	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0006355	regulation of transcription, DNA-templated	IBA	biological process
GO:0005667	transcription regulator complex	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0045165	cell fate commitment	IEA	biological process
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000976	transcription regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0021510	spinal cord development	IEA	biological process
GO:0032993	protein-DNA complex	IEA	cellular component
GO:0065004	protein-DNA complex assembly	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0045591	positive regulation of regulatory T cell differentiation	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0003677	DNA binding	ISS	molecular function
GO:0045591	positive regulation of regulatory T cell differentiation	ISS	biological process
GO:0021510	spinal cord development	ISS	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	ISS	molecular function
GO:0003677	DNA binding	ISS	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)