• Gene id: 6649

Gene Summary

• Gene Symbol: SOD3   Gene   UCSC   Ensembl
• Aliases: EC-SOD
• Gene name: superoxide dismutase 3
• Alternate names: extracellular superoxide dismutase [Cu-Zn], superoxide dismutase 3, extracellular, testicular tissue protein Li 175,
• Gene location: 4p15.2 (24795477: 24800844)     Exons: 3     NC_000004.12
• Gene summary(Entrez): This gene encodes a member of the superoxide dismutase (SOD) protein family. SODs are antioxidant enzymes that catalyze the conversion of superoxide radicals into hydrogen peroxide and oxygen, which may protect the brain, lungs, and other tissues from oxi
• OMIM: 609720

Protein Summary

• Protein general information: P08294  
  • Name: Extracellular superoxide dismutase [Cu Zn] (EC SOD) (EC 1.15.1.1)
  • Length: 240  
  • Mass: 25851
  • Tissue specificity: Expressed in blood vessels, heart, lung, kidney and placenta. Major SOD isoenzyme in extracellular fluids such as plasma, lymph and synovial fluid.
• Sequence:

  MLALLCSCLLLAAGASDAWTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGALHAACQVQPSATLDAAQ
  PRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGCESTGPHYNPLAVPHPQHPGDFGNFA
  VRDGSLWRYRAGLAASLAGPHSIVGRAVVVHAGEDDLGRGGNQASVENGNAGRRLACCVVGVCGPGLWERQAREH
  SERKKRRRESECKAA

• Structural information:
  • Interpro: IPR036423  IPR024134  IPR018152  IPR001424  
  • Prosite: PS00087 PS00332
  • CDD: cd00305
  • PDB: 2JLP
  • PDBsum: 2JLP
  • STRING: ENSP00000371554
• Other Databases: GeneCards:  SOD3  Malacards:  SOD3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004784	superoxide dismutase activity	IBA	molecular function
GO:0005507	copper ion binding	IBA	molecular function
GO:0005576	extracellular region	IBA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0019430	removal of superoxide radicals	IBA	biological process
GO:0004784	superoxide dismutase activity	IEA	molecular function
GO:0006801	superoxide metabolic process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0008201	heparin binding	IEA	molecular function
GO:0016209	antioxidant activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0004784	superoxide dismutase activity	TAS	molecular function
GO:0004784	superoxide dismutase activity	IEA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0034599	cellular response to oxidative stress	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0062023	collagen-containing extracellular matrix	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0004784	superoxide dismutase activity	IEA	molecular function
GO:0062023	collagen-containing extracellular matrix	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0004784	superoxide dismutase activity	IEA	molecular function
GO:0001666	response to hypoxia	IEA	biological process
GO:0046688	response to copper ion	IEA	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	colocalizes with
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	HDA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0062023	collagen-containing extracellular matrix	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Heart disease	PMID:16014615
Polyneuropathy	PMID:12815947
Chronic obstructive pulmonary disease	PMID:16399992
Coronary artery disease	PMID:10811593
Myocardial infarction	PMID:14592844
Myocardial infarction	PMID:14592844
oral cavity cancer	PMID:23057317
intermediate coronary syndrome	PMID:14592844
Diabetic retinopathy	PMID:12663605
diabetes mellitus	PMID:12830380
type 2 diabetes mellitus	PMID:15990193
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq