• Gene id: 6643

Gene Summary

• Gene Symbol: SNX2   Gene   UCSC   Ensembl
• Aliases: TRG-9
• Gene name: sorting nexin 2
• Alternate names: sorting nexin-2, CTB-36H16.2, transformation-related gene 9 protein,
• Gene location: 5q23.2 (122774995: 122834542)     Exons: 15     NC_000005.10
• Gene summary(Entrez): This gene belongs to the sorting nexin family whose members contain the phosphoinositide-binding phox (PX) domain. The encoded protein is a component of the retromer complex which plays a role in protein sorting in the endocytic pathway. This protein may
• OMIM: 605929

Protein Summary

• Protein general information: O60749  
  • Name: Sorting nexin 2 (Transformation related gene 9 protein) (TRG 9)
  • Length: 519  
  • Mass: 58471
• Sequence:

  MAAEREPPPLGDGKPTDFEDLEDGEDLFTSTVSTLESSPSSPEPASLPAEDISANSNGPKPTEVVLDDDREDLFA
  EATEEVSLDSPEREPILSSEPSPAVTPVTPTTLIAPRIESKSMSAPVIFDRSREEIEEEANGDIFDIEIGVSDPE
  KVGDGMNAYMAYRVTTKTSLSMFSKSEFSVKRRFSDFLGLHSKLASKYLHVGYIVPPAPEKSIVGMTKVKVGKED
  SSSTEFVEKRRAALERYLQRTVKHPTLLQDPDLRQFLESSELPRAVNTQALSGAGILRMVNKAADAVNKMTIKMN
  ESDAWFEEKQQQFENLDQQLRKLHVSVEALVCHRKELSANTAAFAKSAAMLGNSEDHTALSRALSQLAEVEEKID
  QLHQEQAFADFYMFSELLSDYIRLIAAVKGVFDHRMKCWQKWEDAQITLLKKREAEAKMMVANKPDKIQQAKNEI
  REWEAKVQQGERDFEQISKTIRKEVGRFEKERVKDFKTVIIKYLESLVQTQQQLIKYWEAFLPEAKAIA

• Structural information:
  • Protein Domains: (140..26-)
    (/note="PX-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00147-)
    (299..51-)
    (/note="BAR-)
    (/evidence="ECO:0000250|UniProtKB:Q13596"-)
  • Interpro: IPR027267  IPR001683  IPR036871  IPR028653  IPR037918   IPR039358  IPR005329  IPR015404  
  • Prosite: PS50195
  • CDD: cd07282
  • STRING: ENSP00000368831
• Other Databases: GeneCards:  SNX2  Malacards:  SNX2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0030904	retromer complex	IDA	cellular component
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0030905	retromer, tubulation complex	NAS	cellular component
GO:0030905	retromer, tubulation complex	IPI	cellular component
GO:0042147	retrograde transport, endosome to Golgi	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0034498	early endosome to Golgi transport	IBA	biological process
GO:0005768	endosome	IBA	cellular component
GO:0035091	phosphatidylinositol binding	IBA	molecular function
GO:0010008	endosome membrane	IBA	cellular component
GO:0072673	lamellipodium morphogenesis	IDA	biological process
GO:0030904	retromer complex	IDA	cellular component
GO:0010008	endosome membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042147	retrograde transport, endosome to Golgi	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006886	intracellular protein transport	IEA	biological process
GO:0006897	endocytosis	IEA	biological process
GO:0030904	retromer complex	IEA	cellular component
GO:0035091	phosphatidylinositol binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0045296	cadherin binding	HDA	molecular function
GO:0031901	early endosome membrane	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005154	epidermal growth factor receptor binding	IDA	molecular function
GO:0032991	protein-containing complex	IDA	cellular component
GO:1990459	transferrin receptor binding	IDA	molecular function
GO:1990460	leptin receptor binding	IDA	molecular function
GO:0005158	insulin receptor binding	IDA	molecular function
GO:0016020	membrane	IDA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881