• Gene id: 6637

Gene Summary

• Gene Symbol: SNRPG   Gene   UCSC   Ensembl
• Aliases: SMG, Sm-G
• Gene name: small nuclear ribonucleoprotein polypeptide G
• Alternate names: small nuclear ribonucleoprotein G, sm protein G, snRNP-G,
• Gene location: 2p13.3 (70293770: 70281361)     Exons: 8     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a component of the U1, U2, U4, and U5 small nuclear ribonucleoprotein complexes, precursors of the spliceosome. The encoded protein may also be a part of the U7 small nuclear ribonucleoprotein complex, which participate
• OMIM: 603542

Protein Summary

• Protein general information: P62308  
  • Name: Small nuclear ribonucleoprotein G (snRNP G) (Sm protein G) (Sm G) (SmG)
  • Length: 76  
  • Mass: 8496
• Sequence:

  MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALER
  V

• Structural information:
  • Interpro: IPR001163  IPR010920  IPR034098  
  • CDD: cd01719
  • PDB: 3CW1 3JCR 3PGW 4F7U 4PJO 4V98 4WZJ 5MQF 5O9Z 5XJC 5XJL 5XJQ 5XJR 5XJT 5XJU 5YZG 5Z56 5Z57 5Z58 6AH0 6AHD 6FF7 6ICZ 6ID0 6ID1 6QDV 6QW6 6QX9
  • PDBsum: 3CW1 3JCR 3PGW 4F7U 4PJO 4V98 4WZJ 5MQF 5O9Z 5XJC 5XJL 5XJQ 5XJR 5XJT 5XJU 5YZG 5Z56 5Z57 5Z58 6AH0 6AHD 6FF7 6ICZ 6ID0 6ID1 6QDV 6QW6 6QX9
  • DIP: 34627
  • STRING: ENSP00000272348
• Other Databases: GeneCards:  SNRPG  Malacards:  SNRPG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0008380	RNA splicing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0006369	termination of RNA polymerase II transcription	TAS	biological process
GO:0008334	histone mRNA metabolic process	TAS	biological process
GO:0008334	histone mRNA metabolic process	TAS	biological process
GO:0008334	histone mRNA metabolic process	TAS	biological process
GO:0008334	histone mRNA metabolic process	TAS	biological process
GO:0051170	import into nucleus	TAS	biological process
GO:0000387	spliceosomal snRNP assembly	TAS	biological process
GO:0000387	spliceosomal snRNP assembly	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005683	U7 snRNP	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0008380	RNA splicing	TAS	biological process
GO:0000245	spliceosomal complex assembly	NAS	biological process
GO:0030532	small nuclear ribonucleoprotein complex	NAS	cellular component
GO:0005681	spliceosomal complex	TAS	cellular component
GO:1990904	ribonucleoprotein complex	IBA	cellular component
GO:0097526	spliceosomal tri-snRNP complex	IBA	cellular component
GO:0071013	catalytic step 2 spliceosome	IBA	cellular component
GO:0043186	P granule	IBA	cellular component
GO:0005689	U12-type spliceosomal complex	IBA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IBA	biological process
GO:0071011	precatalytic spliceosome	IBA	cellular component
GO:0071004	U2-type prespliceosome	IBA	cellular component
GO:0034719	SMN-Sm protein complex	IBA	cellular component
GO:0005687	U4 snRNP	IBA	cellular component
GO:0005686	U2 snRNP	IBA	cellular component
GO:0005685	U1 snRNP	IBA	cellular component
GO:0005682	U5 snRNP	IBA	cellular component
GO:0071013	catalytic step 2 spliceosome	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005689	U12-type spliceosomal complex	IDA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IC	biological process
GO:0000387	spliceosomal snRNP assembly	IDA	biological process
GO:0034719	SMN-Sm protein complex	IDA	cellular component
GO:0034709	methylosome	IDA	cellular component
GO:0005687	U4 snRNP	IDA	cellular component
GO:0005685	U1 snRNP	IDA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IDA	biological process
GO:0071005	U2-type precatalytic spliceosome	IDA	cellular component
GO:0071007	U2-type catalytic step 2 spliceosome	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005685	U1 snRNP	IDA	cellular component
GO:0046540	U4/U6 x U5 tri-snRNP complex	IDA	cellular component
GO:0000387	spliceosomal snRNP assembly	IEA	biological process
GO:0005681	spliceosomal complex	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03040	Spliceosome

Diseases

Associated diseases	References
nasopharynx carcinoma	PMID:24080422
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881