• Gene id: 6631

Gene Summary

• Gene Symbol: SNRPC   Gene   UCSC   Ensembl
• Aliases: U1C, Yhc1
• Gene name: small nuclear ribonucleoprotein polypeptide C
• Alternate names: U1 small nuclear ribonucleoprotein C, U1 small nuclear RNP specific C, U1 snRNP C, U1 snRNP protein C,
• Gene location: 6p21.31 (34757093: 34773856)     Exons: 6     NC_000006.12
• Gene summary(Entrez): This gene encodes one of the specific protein components of the U1 small nuclear ribonucleoprotein (snRNP) particle required for the formation of the spliceosome. The encoded protein participates in the processing of nuclear precursor messenger RNA splici
• OMIM: 603522

Protein Summary

• Protein general information: P09234  
  • Name: U1 small nuclear ribonucleoprotein C (U1 snRNP C) (U1 C) (U1C)
  • Length: 159  
  • Mass: 17394
• Sequence:

  MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGA
  MIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPT
  RPGMTRPDR

• Structural information:
  • Interpro: IPR000690  IPR003604  IPR013085  IPR017340  IPR036236  
  • Prosite: PS50171
  • PDB: 2VRD 3CW1 4PJO 6ELD 6QX9
  • PDBsum: 2VRD 3CW1 4PJO 6ELD 6QX9
  • DIP: 34235
  • STRING: ENSP00000244520
• Other Databases: GeneCards:  SNRPC  Malacards:  SNRPC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030627	pre-mRNA 5'-splice site binding	IBA	molecular function
GO:0000395	mRNA 5'-splice site recognition	IBA	biological process
GO:0005685	U1 snRNP	IBA	cellular component
GO:0005685	U1 snRNP	IDA	cellular component
GO:0000387	spliceosomal snRNP assembly	IEA	biological process
GO:0000398	mRNA splicing, via spliceosome	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005685	U1 snRNP	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990446	U1 snRNP binding	IEA	molecular function
GO:0005685	U1 snRNP	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0000387	spliceosomal snRNP assembly	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003729	mRNA binding	IEA	molecular function
GO:0000243	commitment complex	IEA	cellular component
GO:0000395	mRNA 5'-splice site recognition	IEA	biological process
GO:0071004	U2-type prespliceosome	IEA	cellular component
GO:0005685	U1 snRNP	IEA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IDA	biological process
GO:0008270	zinc ion binding	IDA	molecular function
GO:0000387	spliceosomal snRNP assembly	IDA	biological process
GO:0030619	U1 snRNA binding	IDA	NOT|molecular function
GO:0005685	U1 snRNP	IDA	cellular component
GO:0005685	U1 snRNP	IDA	cellular component
GO:0003727	single-stranded RNA binding	IDA	molecular function
GO:0015030	Cajal body	IDA	cellular component
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03040	Spliceosome

Diseases

Associated diseases	References
Mixed connective tissue disease	PMID:10555891
Connective tissue disease	PMID:2968364
Systemic lupus erythematosus	PMID:8647956
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray