• Gene id: 6629

Gene Summary

• Gene Symbol: SNRPB2   Gene   UCSC   Ensembl
• Aliases: Msl1, U2B''
• Gene name: small nuclear ribonucleoprotein polypeptide B2
• Alternate names: U2 small nuclear ribonucleoprotein B'', U2 snRNP B'', small nuclear ribonucleoprotein polypeptide B,
• Gene location: 20p12.1 (16730025: 16742563)     Exons: 7     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene associates with stem loop IV of U2 small nuclear ribonucleoprotein (U2 snRNP) in the presence of snRNP-A'. The encoded protein may play a role in pre-mRNA splicing. Autoantibodies from patients with systemic lupus erythema
• OMIM: 603520

Protein Summary

• Protein general information: P08579  
  • Name: U2 small nuclear ribonucleoprotein B'' (U2 snRNP B'')
  • Length: 225  
  • Mass: 25486
• Sequence:

  MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFY
  GKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPN
  YILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK

• Structural information:
  • Protein Domains: (7..8-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (151..22-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR012677  IPR035979  IPR000504  IPR034564  IPR034562  
  • Prosite: PS50102
  • CDD: cd12478 cd12481
  • PDB: 1A9N 5MQF 5O9Z 5XJC 5YZG 5Z56 5Z57 5Z58 6AH0 6AHD 6FF7 6ICZ 6ID0 6ID1 6QDV 6QX9
  • PDBsum: 1A9N 5MQF 5O9Z 5XJC 5YZG 5Z56 5Z57 5Z58 6AH0 6AHD 6FF7 6ICZ 6ID0 6ID1 6QDV 6QX9
  • STRING: ENSP00000246071
• Other Databases: GeneCards:  SNRPB2  Malacards:  SNRPB2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005681	spliceosomal complex	IDA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IC	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0071013	catalytic step 2 spliceosome	IBA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IBA	biological process
GO:0030619	U1 snRNA binding	IBA	molecular function
GO:0005686	U2 snRNP	IBA	cellular component
GO:0005685	U1 snRNP	IBA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IDA	biological process
GO:0071013	catalytic step 2 spliceosome	IDA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IC	biological process
GO:0000398	mRNA splicing, via spliceosome	IDA	biological process
GO:0071007	U2-type catalytic step 2 spliceosome	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0071005	U2-type precatalytic spliceosome	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030532	small nuclear ribonucleoprotein complex	IEA	cellular component
GO:0070990	snRNP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0001650	fibrillar center	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0005686	U2 snRNP	IDA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IC	biological process

KEGG pathways

Pathway id	Pathway name
hsa03040	Spliceosome

Diseases

Associated diseases	References
Connective tissue disease	PMID:2968364
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881