• Gene id: 6628

Gene Summary

• Gene Symbol: SNRPB   Gene   UCSC   Ensembl
• Aliases: CCMS, COD, SNRPB1, Sm-B/B', SmB/B', SmB/SmB', snRNP-B
• Gene name: small nuclear ribonucleoprotein polypeptides B and B1
• Alternate names: small nuclear ribonucleoprotein-associated proteins B and B', B polypeptide of Sm protein, Sm protein B/B', sm-B/Sm-B', small nuclear ribonucleoprotein polypeptide B, small nuclear ribonucleoprotein polypeptides B and B',
• Gene location: 20p13 (2470788: 2461641)     Exons: 7     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a ro
• OMIM: 182282

Protein Summary

• Protein general information: P14678  
  • Name: Small nuclear ribonucleoprotein associated proteins B and B' (snRNP B) (Sm protein B/B') (Sm B/B') (SmB/B')
  • Length: 240  
  • Mass: 24610
• Sequence:

  MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGE
  NLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTV
  AAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPP
  GMRGPPPPGMRPPRP

• Structural information:
  • Interpro: IPR001163  IPR010920  IPR017131  
  • PDB: 1D3B 3CW1 3JCR 3PGW 4PJO 4WZJ 5MQF 5O9Z 5XJC 5YZG 5Z56 5Z57 5Z58 6AH0 6FF7 6ICZ 6ID0 6ID1 6QDV 6QW6 6QX9
  • PDBsum: 1D3B 3CW1 3JCR 3PGW 4PJO 4WZJ 5MQF 5O9Z 5XJC 5YZG 5Z56 5Z57 5Z58 6AH0 6FF7 6ICZ 6ID0 6ID1 6QDV 6QW6 6QX9
  • DIP: 31239
  • STRING: ENSP00000412566
• Other Databases: GeneCards:  SNRPB  Malacards:  SNRPB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000398	mRNA splicing, via spliceosome	IBA	biological process
GO:0071013	catalytic step 2 spliceosome	IBA	cellular component
GO:0005682	U5 snRNP	IBA	cellular component
GO:0005685	U1 snRNP	IBA	cellular component
GO:0005686	U2 snRNP	IBA	cellular component
GO:0005687	U4 snRNP	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0046540	U4/U6 x U5 tri-snRNP complex	IBA	cellular component
GO:0071004	U2-type prespliceosome	IBA	cellular component
GO:0071013	catalytic step 2 spliceosome	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005689	U12-type spliceosomal complex	IDA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IC	biological process
GO:0000387	spliceosomal snRNP assembly	IDA	biological process
GO:0034719	SMN-Sm protein complex	IDA	cellular component
GO:0034709	methylosome	IDA	cellular component
GO:0005687	U4 snRNP	IDA	cellular component
GO:0005685	U1 snRNP	IDA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IDA	biological process
GO:0000398	mRNA splicing, via spliceosome	IDA	biological process
GO:0071007	U2-type catalytic step 2 spliceosome	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005685	U1 snRNP	IDA	cellular component
GO:0046540	U4/U6 x U5 tri-snRNP complex	IDA	cellular component
GO:0071005	U2-type precatalytic spliceosome	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008380	RNA splicing	TAS	biological process
GO:0005681	spliceosomal complex	TAS	cellular component
GO:0030532	small nuclear ribonucleoprotein complex	TAS	cellular component
GO:0006479	protein methylation	IDA	biological process
GO:0006369	termination of RNA polymerase II transcription	TAS	biological process
GO:0008334	histone mRNA metabolic process	TAS	biological process
GO:0008334	histone mRNA metabolic process	TAS	biological process
GO:0008334	histone mRNA metabolic process	TAS	biological process
GO:0008334	histone mRNA metabolic process	TAS	biological process
GO:0051170	import into nucleus	TAS	biological process
GO:0000387	spliceosomal snRNP assembly	TAS	biological process
GO:0000387	spliceosomal snRNP assembly	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990447	U2 snRNP binding	IEA	molecular function
GO:0071208	histone pre-mRNA DCP binding	IEA	molecular function
GO:0071204	histone pre-mRNA 3'end processing complex	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:1990446	U1 snRNP binding	IEA	molecular function
GO:0007420	brain development	IEA	biological process
GO:0005686	U2 snRNP	IEA	cellular component
GO:0005685	U1 snRNP	IEA	cellular component
GO:0070034	telomerase RNA binding	IPI	molecular function
GO:0005697	telomerase holoenzyme complex	IDA	cellular component
GO:0003723	RNA binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005683	U7 snRNP	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03040	Spliceosome
hsa05322	Systemic lupus erythematosus

Diseases

Associated diseases	References
Cerebrocostomandibular syndrome	KEGG:H01843
Cerebrocostomandibular syndrome	KEGG:H01843
Mixed connective tissue disease	PMID:2968364
lung adenocarcinoma	PMID:22876301
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881