• Gene id: 6626

Gene Summary

• Gene Symbol: SNRPA   Gene   UCSC   Ensembl
• Aliases: Mud1, U1-A, U1A
• Gene name: small nuclear ribonucleoprotein polypeptide A
• Alternate names: U1 small nuclear ribonucleoprotein A, U1 small nuclear RNP-specific A, U1 snRNP A, U1 snRNP-specific protein A,
• Gene location: 19q13.2 (40751202: 40765388)     Exons: 6     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene associates with stem loop II of the U1 small nuclear ribonucleoprotein, which binds the 5' splice site of precursor mRNAs and is required for splicing. The encoded protein autoregulates itself by polyadenylation inhibition
• OMIM: 182455

Protein Summary

• Protein general information: P09012  
  • Name: U1 small nuclear ribonucleoprotein A (U1 snRNP A) (U1 A) (U1A)
  • Length: 282  
  • Mass: 31280
• Sequence:

  MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGF
  PFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQA
  PRIMHHMPGQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLS
  MLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFAKK

• Structural information:
  • Protein Domains: (10..8-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (208..28-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR012677  IPR035979  IPR000504  IPR034407  IPR034409  
  • Prosite: PS50102
  • CDD: cd12477 cd12480
  • PDB: 1AUD 1DRZ 1DZ5 1FHT 1M5K 1M5O 1M5P 1M5V 1NU4 1OIA 1SJ3 1SJ4 1SJF 1U6B 1URN 1VBX 1VBY 1VBZ 1VC0 1VC5 1VC6 1ZZN 2A3J 2NZ4 2OIH 2OJ3 2U1A 3BO2 3BO3 3BO4 3CUL 3CUN 3EGZ 3G8S 3G8T 3G96 3G9C 3HHN 3IIN 3IRW 3IWN 3K0J 3L3C 3MUM 3MUR 3MUT 3MUV 3MXH 3P49 3PGW 3R1H 3R1L 3UCU 3UCZ 3UD3 3UD4 3UTR 4C4W 4PR6 4PRF 4W90 4W92 4YB1 5DD
  • PDBsum: 1AUD 1DRZ 1DZ5 1FHT 1M5K 1M5O 1M5P 1M5V 1NU4 1OIA 1SJ3 1SJ4 1SJF 1U6B 1URN 1VBX 1VBY 1VBZ 1VC0 1VC5 1VC6 1ZZN 2A3J 2NZ4 2OIH 2OJ3 2U1A 3BO2 3BO3 3BO4 3CUL 3CUN 3EGZ 3G8S 3G8T 3G96 3G9C 3HHN 3IIN 3IRW 3IWN 3K0J 3L3C 3MUM 3MUR 3MUT 3MUV 3MXH 3P49 3PGW 3R1H 3R1L 3UCU 3UCZ 3UD3 3UD4 3UTR 4C4W 4PR6 4PRF 4W90 4W92 4YB1 5DD
  • DIP: 29407
  • STRING: ENSP00000243563
• Other Databases: GeneCards:  SNRPA  Malacards:  SNRPA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005681	spliceosomal complex	IDA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IC	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000398	mRNA splicing, via spliceosome	IBA	biological process
GO:0005685	U1 snRNP	IBA	cellular component
GO:0030619	U1 snRNA binding	IBA	molecular function
GO:0030619	U1 snRNA binding	IDA	molecular function
GO:0005685	U1 snRNP	IDA	cellular component
GO:0003723	RNA binding	IDA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0008380	RNA splicing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990446	U1 snRNP binding	IEA	molecular function
GO:1900363	regulation of mRNA polyadenylation	IEA	biological process
GO:0005685	U1 snRNP	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005685	U1 snRNP	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03040	Spliceosome

Diseases

Associated diseases	References
Alzheimer's disease	PMID:24023061
Connective tissue disease	PMID:2968364
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq