• Gene id: 6622

Gene Summary

• Gene Symbol: SNCA   Gene   UCSC   Ensembl
• Aliases: NACP, PARK1, PARK4, PD1
• Gene name: synuclein alpha
• Alternate names: alpha-synuclein, I+/--synuclein, non A-beta component of AD amyloid, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein,
• Gene location: 4q22.1 (89838323: 89724098)     Exons: 13     NC_000004.12
• Gene summary(Entrez): Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynapti
• OMIM: 163890

Protein Summary

• Protein general information: P37840  
  • Name: Alpha synuclein (Non A beta component of AD amyloid) (Non A4 component of amyloid precursor) (NACP)
  • Length: 140  
  • Mass: 14460
  • Tissue specificity: Highly expressed in presynaptic terminals in the central nervous system. Expressed principally in brain. {ECO
• Sequence:

  MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVT
  AVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

• Structural information:
  • Interpro: IPR001058  IPR002460  
  • PDB: 1XQ8 2JN5 2KKW 2M55 2N0A 2X6M 3Q25 3Q26 3Q27 3Q28 3Q29 4BXL 4R0U 4R0W 4RIK 4RIL 4ZNN 5CRW 6A6B 6CT7 6CU7 6CU8 6FLT 6H6B 6OSJ 6OSL 6OSM 6PEO 6PES 6RT0 6RTB 6SST 6SSX
  • PDBsum: 1XQ8 2JN5 2KKW 2M55 2N0A 2X6M 3Q25 3Q26 3Q27 3Q28 3Q29 4BXL 4R0U 4R0W 4RIK 4RIL 4ZNN 5CRW 6A6B 6CT7 6CU7 6CU8 6FLT 6H6B 6OSJ 6OSL 6OSM 6PEO 6PES 6RT0 6RTB 6SST 6SSX
  • DIP: 35354
  • STRING: ENSP00000338345
• Other Databases: GeneCards:  SNCA  Malacards:  SNCA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003779	actin binding	IPI	molecular function
GO:0004860	protein kinase inhibitor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006469	negative regulation of protein kinase activity	TAS	biological process
GO:0051621	regulation of norepinephrine uptake	IGI	biological process
GO:0022898	regulation of transmembrane transporter activity	IGI	biological process
GO:1901215	negative regulation of neuron death	IDA	biological process
GO:1903284	positive regulation of glutathione peroxidase activity	IDA	biological process
GO:1903285	positive regulation of hydrogen peroxide catabolic process	IDA	biological process
GO:0005576	extracellular region	IDA	cellular component
GO:0000976	transcription regulatory region sequence-specific DNA binding	TAS	molecular function
GO:1903421	regulation of synaptic vesicle recycling	TAS	biological process
GO:0050729	positive regulation of inflammatory response	IDA	biological process
GO:1904715	negative regulation of chaperone-mediated autophagy	IMP	biological process
GO:0034599	cellular response to oxidative stress	IC	biological process
GO:0005764	lysosome	TAS	cellular component
GO:1901216	positive regulation of neuron death	IDA	biological process
GO:0005543	phospholipid binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:1905606	regulation of presynapse assembly	IGI	biological process
GO:0016234	inclusion body	IDA	cellular component
GO:1903426	regulation of reactive oxygen species biosynthetic process	TAS	biological process
GO:0043065	positive regulation of apoptotic process	TAS	biological process
GO:0099512	supramolecular fiber	IDA	cellular component
GO:0099512	supramolecular fiber	IDA	cellular component
GO:1902957	negative regulation of mitochondrial electron transport, NADH to ubiquinone	TAS	biological process
GO:0005739	mitochondrion	TAS	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	TAS	biological process
GO:0001774	microglial cell activation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0035543	positive regulation of SNARE complex assembly	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005507	copper ion binding	IDA	molecular function
GO:0042802	identical protein binding	IDA	molecular function
GO:0016020	membrane	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0042802	identical protein binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0016079	synaptic vesicle exocytosis	IDA	biological process
GO:0051262	protein tetramerization	IDA	biological process
GO:0035493	SNARE complex assembly	IDA	biological process
GO:0000149	SNARE binding	IDA	molecular function
GO:0016082	synaptic vesicle priming	IMP	biological process
GO:0045921	positive regulation of exocytosis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0014059	regulation of dopamine secretion	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048156	tau protein binding	IDA	molecular function
GO:0051219	phosphoprotein binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0031115	negative regulation of microtubule polymerization	IDA	biological process
GO:0032769	negative regulation of monooxygenase activity	IDA	biological process
GO:0071902	positive regulation of protein serine/threonine kinase activity	IDA	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:1903136	cuprous ion binding	IMP	molecular function
GO:0070555	response to interleukin-1	IDA	biological process
GO:0070495	negative regulation of thrombin-activated receptor signaling pathway	IDA	biological process
GO:0055074	calcium ion homeostasis	IDA	NOT|biological process
GO:0051612	negative regulation of serotonin uptake	IDA	biological process
GO:0048156	tau protein binding	IDA	molecular function
GO:0045807	positive regulation of endocytosis	IDA	biological process
GO:0042393	histone binding	IDA	molecular function
GO:0035067	negative regulation of histone acetylation	IDA	biological process
GO:0030424	axon	IDA	cellular component
GO:0071280	cellular response to copper ion	IDA	biological process
GO:0051585	negative regulation of dopamine uptake involved in synaptic transmission	IDA	biological process
GO:0051281	positive regulation of release of sequestered calcium ion into cytosol	IDA	biological process
GO:0099512	supramolecular fiber	IDA	cellular component
GO:0043027	cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IDA	molecular function
GO:0032410	negative regulation of transporter activity	IDA	biological process
GO:0032026	response to magnesium ion	IDA	biological process
GO:0031623	receptor internalization	IDA	biological process
GO:0010517	regulation of phospholipase activity	IDA	biological process
GO:0008198	ferrous iron binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0001921	positive regulation of receptor recycling	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0060961	phospholipase D inhibitor activity	IDA	NOT|molecular function
GO:0060732	positive regulation of inositol phosphate biosynthetic process	IDA	biological process
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0034341	response to interferon-gamma	IDA	biological process
GO:0031648	protein destabilization	IDA	biological process
GO:0031092	platelet alpha granule membrane	IDA	colocalizes with
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0010642	negative regulation of platelet-derived growth factor receptor signaling pathway	IDA	biological process
GO:0010040	response to iron(II) ion	IDA	biological process
GO:0008270	zinc ion binding	IDA	molecular function
GO:0005938	cell cortex	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005509	calcium ion binding	IDA	molecular function
GO:0005509	calcium ion binding	IDA	molecular function
GO:0005507	copper ion binding	IDA	molecular function
GO:0005504	fatty acid binding	IDA	NOT|molecular function
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0051622	negative regulation of norepinephrine uptake	IDA	biological process
GO:0032496	response to lipopolysaccharide	IDA	biological process
GO:0030426	growth cone	IDA	cellular component
GO:0016491	oxidoreductase activity	IDA	molecular function
GO:0016234	inclusion body	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0032991	protein-containing complex	IMP	cellular component
GO:0071872	cellular response to epinephrine stimulus	TAS	biological process
GO:0097435	supramolecular fiber organization	TAS	biological process
GO:0030544	Hsp70 protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048488	synaptic vesicle endocytosis	ISS	biological process
GO:0030544	Hsp70 protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051583	dopamine uptake involved in synaptic transmission	TAS	biological process
GO:0045920	negative regulation of exocytosis	IMP	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0014059	regulation of dopamine secretion	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070840	dynein complex binding	IPI	molecular function
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process
GO:0043014	alpha-tubulin binding	IPI	molecular function
GO:0042416	dopamine biosynthetic process	TAS	biological process
GO:0019894	kinesin binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa05012	Parkinson disease

Diseases

Associated diseases	References
Parkinson disease	KEGG:H00057
Parkinsonian syndrome	KEGG:H01600
Lewy body dementia	KEGG:H00066
Parkinson disease	KEGG:H00057
Parkinsonian syndrome	KEGG:H01600
Lewy body dementia	KEGG:H00066
Alzheimer's disease	PMID:18577885
Alzheimer's disease	PMID:11572944
Pick's disease	PMID:12410393
Creutzfeldt-Jakob disease	PMID:18625222
Lewy body dementia	PMID:10557341
Lewy body dementia	PMID:18577885
Lewy body dementia	PMID:18625222
Lewy body dementia	PMID:11733371
Lewy body dementia	PMID:20697047
Parkinson's disease	PMID:18625222
Parkinson's disease	PMID:10651022
Parkinson's disease	PMID:17448146
Mental depression	PMID:19198857
Bipolar disorder	PMID:19198857
pantothenate kinase-associated neurodegeneration	PMID:10934140
Multiple system atrophy	PMID:9749615
Schizophrenia	PMID:19198857
myeloid leukemia	PMID:21264917
Vascular dementia	PMID:18577885
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)