• Gene id: 662

Gene Summary

• Gene Symbol: BNIP1   Gene   UCSC   Ensembl
• Aliases: NIP1, SEC20, TRG-8
• Gene name: BCL2 interacting protein 1
• Alternate names: vesicle transport protein SEC20, BCL2/adenovirus E1B 19 kDa protein-interacting protein 1, BCL2/adenovirus E1B 19kDa interacting protein 1, transformation-related gene 8 protein,
• Gene location: 5q35.1 (75786193: 75795089)     Exons: 11     NC_000001.11
• Gene summary(Entrez): This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein, which protects cells from virally-induced cell death. The encoded protein also interacts with E1B 19 kDa-like sequences of
• OMIM: 603291

Protein Summary

• Protein general information: Q12981  
  • Name: Vesicle transport protein SEC20 (BCL2/adenovirus E1B 19 kDa protein interacting protein 1) (Transformation related gene 8 protein) (TRG 8)
  • Length: 228  
  • Mass: 26132
  • Tissue specificity: Isoform 1 is highly expressed in heart, brain, liver skeletal muscle and pancreas. Isoform 3 is moderately expressed in placenta, lung and kidney. Isoform 4 is highly expressed in testis and small intestine. {ECO
• Sequence:

  MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQDLEQLAKEQDKESEKQ
  LLLQEVENHKKQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDLLRQRKTTKESLAQTSSTITESLMGISRMMA
  QQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALALFLATVLYIVKKRLF
  PFL

• Structural information:
  • Interpro: IPR005606  
• Other Databases: GeneCards:  BNIP1  Malacards:  BNIP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007029	endoplasmic reticulum organization	IMP	biological process
GO:0031201	SNARE complex	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030176	integral component of endoplasmic reticulum membrane	TAS	cellular component
GO:0016320	endoplasmic reticulum membrane fusion	IMP	biological process
GO:0031201	SNARE complex	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IBA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0031966	mitochondrial membrane	IDA	cellular component
GO:0031966	mitochondrial membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005484	SNAP receptor activity	IEA	molecular function
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IEA	biological process
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006915	apoptotic process	IPI	biological process
GO:0006915	apoptotic process	IPI	biological process
GO:0005484	SNAP receptor activity	IDA	molecular function
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0014823	response to activity	IEA	biological process
GO:0031201	SNARE complex	IEA	cellular component
GO:0042594	response to starvation	IEA	biological process
GO:0090649	response to oxygen-glucose deprivation	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0030137	COPI-coated vesicle	IEA	cellular component
GO:0097194	execution phase of apoptosis	IC	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04130	SNARE interactions in vesicular transport

Diseases

Associated diseases	References
Down syndrome	PMID:15716609
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881