• Gene id: 6618

Gene Summary

• Gene Symbol: SNAPC2   Gene   UCSC   Ensembl
• Aliases: PTFDELTA, SNAP45
• Gene name: small nuclear RNA activating complex polypeptide 2
• Alternate names: snRNA-activating protein complex subunit 2, PSE-binding factor subunit delta, PTF subunit delta, SNAPC 45 kDa subunit, SNAPc subunit 2, proximal sequence element-binding transcription factor subunit delta, small nuclear RNA activating complex, polypeptide 2, 45,
• Gene location: 19p13.2 (7920337: 7923249)     Exons: 6     NC_000019.10
• Gene summary(Entrez): This gene encodes a subunit of the snRNA-activating protein complex which is associated with the TATA box-binding protein. The encoded protein is necessary for RNA polymerase II and III dependent small-nuclear RNA gene transcription. Alternative splicing
• OMIM: 602689

Protein Summary

• Protein general information: Q13487  
  • Name: snRNA activating protein complex subunit 2 (SNAPc subunit 2) (Proximal sequence element binding transcription factor subunit delta) (PSE binding factor subunit delta) (PTF subunit delta) (Small nuclear RNA activating complex polypeptide 2) (snRNA activati
  • Length: 334  
  • Mass: 35556
• Sequence:

  MKPPPRRRAAPARYLGEVTGPATWSAREKRQLVRLLQARQGQPEPDATELARELRGRSEAEIRVFLQQLKGRVAR
  EAIQKVHPGGLQGPRRREAQPPAPIEVWTDLAEKITGPLEEALAVAFSQVLTIAATEPVTLLHSKPPKPTQARGK
  PLLLSAPGGQEDPAPEIPSSAPAAPSSAPRTPDPAPEKPSESSAGPSTEEDFAVDFEKIYKYLSSVSRSGRSPEL
  SAAESAVVLDLLMSLPEELPLLPCTALVEHMTETYLRLTAPQPIPAGGSLGPAAEGDGAGSKAPEETPPATEKAE
  HSELKSPWQAAGICPLNPFLVPLELLGRAATPAR

• Structural information:
  • Interpro: IPR021281  
  • DIP: 505
  • STRING: ENSP00000221573
• Other Databases: GeneCards:  SNAPC2  Malacards:  SNAPC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016604	nuclear body	IBA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003700	DNA-binding transcription factor activity	TAS	molecular function
GO:0003700	DNA-binding transcription factor activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0006383	transcription by RNA polymerase III	TAS	biological process
GO:0009301	snRNA transcription	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0042795	snRNA transcription by RNA polymerase II	TAS	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq