• Gene id: 6613

Gene Summary

• Gene Symbol: SUMO2   Gene   UCSC   Ensembl
• Aliases: HSMT3, SMT3B, SMT3H2, SUMO3, Smt3A
• Gene name: small ubiquitin like modifier 2
• Alternate names: small ubiquitin-related modifier 2, SMT3 homolog 2, SMT3 suppressor of mif two 3 homolog 2, sentrin 2, ubiquitin-like protein SMT3A, ubiquitin-like protein SMT3B,
• Gene location: 17q25.1 (75182958: 75165585)     Exons: 4     NC_000017.11
• Gene summary(Entrez): This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unl
• OMIM: 603042

Protein Summary

• Protein general information: P61956  
  • Name: Small ubiquitin related modifier 2 (SUMO 2) (HSMT3) (SMT3 homolog 2) (SUMO 3) (Sentrin 2) (Ubiquitin like protein SMT3B) (Smt3B)
  • Length: 95  
  • Mass: 10871
  • Tissue specificity: Broadly expressed. {ECO
• Sequence:

  MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQ
  LEMEDEDTIDVFQQQTGGVY

• Structural information:
  • Protein Domains: (16..9-)
    (/note="Ubiquitin-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00214"-)
  • Interpro: IPR022617  IPR000626  IPR029071  
  • Prosite: PS50053
  • PDB: 1WM2 1WM3 1WZ0 1Z5Q 2AWT 2CKH 2D07 2IO0 2IO3 2IYD 2N1W 2N9E 2RPQ 3UIN 3UIO 3ZO5 4BKG 4NPN 5D2M 5ELU 5EQL 5GHB 5GHC
  • PDBsum: 1WM2 1WM3 1WZ0 1Z5Q 2AWT 2CKH 2D07 2IO0 2IO3 2IYD 2N1W 2N9E 2RPQ 3UIN 3UIO 3ZO5 4BKG 4NPN 5D2M 5ELU 5EQL 5GHB 5GHC
  • DIP: 29253
  • STRING: ENSP00000405965
• Other Databases: GeneCards:  SUMO2  Malacards:  SUMO2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0016605	PML body	IDA	cellular component
GO:0016925	protein sumoylation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0016925	protein sumoylation	IDA	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016605	PML body	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016925	protein sumoylation	IDA	biological process
GO:0016925	protein sumoylation	IDA	biological process
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport
hsa05418	Fluid shear stress and atherosclerosis

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq