• Gene id: 6612

Gene Summary

• Gene Symbol: SUMO3   Gene   UCSC   Ensembl
• Aliases: SMT3A, SMT3H1, SUMO-3, Smt3B
• Gene name: small ubiquitin like modifier 3
• Alternate names: small ubiquitin-related modifier 3, SMT3 suppressor of mif two 3 homolog 1, SMT3 suppressor of mif two 3 homolog 3, ubiquitin-like protein SMT3B,
• Gene location: 21q22.3 (183023419: 183145591)     Exons: 28     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the small ubiquitin-related modifier (SUMO) family of eukaryotic proteins. The encoded protein is covalently conjugated to other proteins via a post-translation modification known as sumoylation. Sumoylation may play a role i
• OMIM: 602231

Protein Summary

• Protein general information: P55854  
  • Name: Small ubiquitin related modifier 3 (SUMO 3) (SMT3 homolog 1) (SUMO 2) (Ubiquitin like protein SMT3A) (Smt3A)
  • Length: 103  
  • Mass: 11637
  • Tissue specificity: Expressed predominantly in liver. {ECO
• Sequence:

  MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQL
  EMEDEDTIDVFQQQTGGVPESSLAGHSF

• Structural information:
  • Protein Domains: (15..9-)
    (/note="Ubiquitin-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00214"-)
  • Interpro: IPR022617  IPR000626  IPR029071  
  • Prosite: PS50053
  • PDB: 1U4A 2IO1 2MP2 6K5R 6NNQ
  • PDBsum: 1U4A 2IO1 2MP2 6K5R 6NNQ
  • DIP: 29255
• Other Databases: GeneCards:  SUMO3  Malacards:  SUMO3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016925	protein sumoylation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0016925	protein sumoylation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000776	kinetochore	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016605	PML body	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043392	negative regulation of DNA binding	IDA	biological process
GO:0016925	protein sumoylation	IDA	biological process
GO:0016925	protein sumoylation	IDA	biological process
GO:0016605	PML body	IDA	cellular component
GO:0016925	protein sumoylation	IDA	biological process
GO:1900180	regulation of protein localization to nucleus	IDA	biological process
GO:0016925	protein sumoylation	IDA	biological process
GO:0016925	protein sumoylation	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport
hsa05418	Fluid shear stress and atherosclerosis

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq