• Gene id: 661

Gene Summary

• Gene Symbol: POLR3D   Gene   UCSC   Ensembl
• Aliases: BN51T, C53, RPC4, RPC53, TSBN51
• Gene name: RNA polymerase III subunit D
• Alternate names: DNA-directed RNA polymerase III subunit RPC4, BN51 (BHK21) temperature sensitivity complementing, DNA-directed RNA polymerase III 47 kDa polypeptide, DNA-directed RNA polymerase III subunit D, RNA polymerase III 47 kDa subunit, RNA polymerase III subunit C4, RP,
• Gene location: 8p21.3 (22245103: 22254600)     Exons: 9     NC_000008.11
• Gene summary(Entrez): This gene complements a temperature-sensitive mutant isolated from the BHK-21 Syrian hamster cell line. It leads to a block in progression through the G1 phase of the cell cycle at nonpermissive temperatures. [provided by RefSeq, Jul 2008]

Protein Summary

• Protein general information: P05423  
  • Name: DNA directed RNA polymerase III subunit RPC4 (RNA polymerase III subunit C4) (DNA directed RNA polymerase III subunit D) (Protein BN51) (RNA polymerase III 47 kDa subunit) (RPC53 homolog)
  • Length: 398  
  • Mass: 44396
• Sequence:

  MSEGNAAGEPSTPGGPRPLLTGARGLIGRRPAPPLTPGRLPSIRSRDLTLGGVKKKTFTPNIISRKIKEEPKEEV
  TVKKEKRERDRDRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDVSDMGPSHIINIKKEKRETDEE
  TKQILRMLEKDDFLDDPGLRNDTRNMPVQLPLAHSGWLFKEENDEPDVKPWLAGPKEEDMEVDIPAVKVKEEPRD
  EEEEAKMKAPPKAARKTPGLPKDVSVAELLRELSLTKEEELLFLQLPDTLPGQPPTQDIKPIKTEVQGEDGQVVL
  IKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTMGTACSFLQELVSVGLGDSRTGEMTV
  LGHVKHKLVCSPDFESLLDHKHR

• Structural information:
  • Interpro: IPR007811  
  • DIP: 56155
  • STRING: ENSP00000380904
• Other Databases: GeneCards:  POLR3D  Malacards:  POLR3D

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005666	RNA polymerase III complex	IBA	cellular component
GO:0045089	positive regulation of innate immune response	IDA	biological process
GO:0032728	positive regulation of interferon-beta production	IDA	biological process
GO:0006383	transcription by RNA polymerase III	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005666	RNA polymerase III complex	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0003899	DNA-directed 5'-3' RNA polymerase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005666	RNA polymerase III complex	IDA	cellular component
GO:0000790	nuclear chromatin	IDA	colocalizes with
GO:0032481	positive regulation of type I interferon production	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0000790	nuclear chromatin	IEA	cellular component
GO:0003682	chromatin binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04623	Cytosolic DNA-sensing pathway
hsa03020	RNA polymerase

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881